KEGG   Lactobacillus oris: AYI71_14450Help
Entry
AYI71_14450       CDS       T04391                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lor  Lactobacillus oris
Pathway
lor00670  One carbon pool by folate
lor00790  Folate biosynthesis
lor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AYI71_14450
   00670 One carbon pool by folate
    AYI71_14450
Enzymes [BR:lor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AYI71_14450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AMS09821
UniProt: A0A142KUN3
Position
complement(2912717..2913214)
Genome map
AA seq 165 aa AA seqDB search
MVKIAFIWAEDEAGWIGKDNDMPWHLSADLKHFKHLTSGHPVIMGKNTYLSLGRPLPKRT
NIVVTRQTTPIEGVTLVNGVNALTNLLANYGEDEEVFIIGGTHLFASTMSLATVLYRTVV
EGNHHGDVKMAPIDYRTWQKVAERHLQATESDPACTFEKWVLNVK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggttaagattgcctttatttgggcggaagatgaggcgggctggattggcaaggacaat
gacatgccctggcacctgtcagccgacttaaagcattttaaacacctcaccagtggtcac
ccggtcatcatggggaaaaacacctacttgtccttggggcggccgctacctaagcggacc
aacatcgtcgtgacccgacaaacgacgccaattgaaggagtcaccctggttaacggggtc
aacgccctgaccaacttgttagccaattacggtgaagacgaggaggtcttcatcattggg
ggcacccacctctttgccagtaccatgtctttagcgaccgtcttgtaccggacggttgtt
gaaggaaaccaccacggcgacgtaaaaatggcgcccatcgactatcgcacctggcaaaaa
gtcgctgagcgccatcttcaagcgaccgagtcggacccggcctgcacctttgaaaagtgg
gtcttaaacgtaaagtaa

DBGET integrated database retrieval system