KEGG   Lactobacillus oris: AYI71_15515Help
Entry
AYI71_15515       CDS       T04391                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
lor  Lactobacillus oris
Pathway
lor00730  Thiamine metabolism
lor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AYI71_15515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lor03000]
    AYI71_15515
Enzymes [BR:lor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     AYI71_15515
Transcription factors [BR:lor03000]
 Prokaryotic Type
  Other transcription factors
   Others
    AYI71_15515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AMS10004
UniProt: A0A142KV66
Position
3128159..3128806
Genome map
AA seq 215 aa AA seqDB search
MTVFTTTLTATINQTTETSARAPFILHLSSGDLPLTTFRYYLIQDNHYLTAFNRLHQEIA
THLPANEGAILSHLGEGEDAARQRMHREIGLGTQELQETPVAPNAYSYITHMYYQLDRYG
AAAAIAGLLPCYWLYSELAQRLAVKHSPVHLYQEFFDSYTAADFTTSTEQMKAIVNQQAA
SVDELGRQQMTRAFQISCYYEEQFWQMAFDQQEWQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttttaccactactttaacagcgacaattaaccaaactaccgaaacgagcgct
cgcgcccccttcattctgcatctcagcagcggcgacctgcctctcacgaccttccgctac
tacctaattcaggacaaccactacctgacggcctttaaccggctccaccaggaaattgcg
acccacttgccagcaaacgaaggcgcgattttaagccacctcggggaaggagaagacgct
gcccgccaacggatgcacagggaaatcggcctgggcacacaggaactgcaagaaactccc
gtcgcccctaacgcatactcctacatcacccatatgtactaccagctagaccgttacggc
gccgcagctgctatcgccggtctccttccctgctactggctgtacagtgagctggcccag
cgtttagccgtcaagcacagcccggttcacctgtaccaggagttctttgacagctacacc
gccgcagatttcactaccagcacggaacaaatgaaggcgatcgtcaaccagcaagccgcg
agtgtcgacgaacttggccgccagcaaatgacccgggcatttcaaatttcctgctactac
gaggagcagttttggcaaatggcctttgaccagcaggaatggcagtag

DBGET integrated database retrieval system