KEGG   Leptotrichia sp. oral taxon 847: AXF11_07985Help
Entry
AXF11_07985       CDS       T04653                                 

Definition
(GenBank) nicotinate-nucleotide adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
lot  Leptotrichia sp. oral taxon 847
Pathway
lot00760  Nicotinate and nicotinamide metabolism
lot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AXF11_07985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lot03000]
    AXF11_07985
Enzymes [BR:lot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     AXF11_07985
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     AXF11_07985
Transcription factors [BR:lot03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    AXF11_07985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 CTP_transf_like Sbi-IV FAD_syn PCI
Motif
Other DBs
NCBI-ProteinID: AMD96039
UniProt: A0A0X8JW68
Position
1711819..1712925
Genome map
AA seq 368 aa AA seqDB search
MKKIGIVVGKFFPLHIGHVNLIQRVSGIVEKVYVVVSYSTDGDDLITSNSRFVKEITPKD
RLRFVKQTFKNQPNVASFLFNEDDCPPYPDGWEKWSKLLKKEIEKRENLSNEKNLDWKND
VIFISNHKDDEKYYLRYFGSQTKSIDENYNEYNVNSQEIRENPSKYWDYLPREVREHLIP
IITICGGESSGKSIMIDKLANVFNTSSAWEYGREYVFEKLGGDEDALQYSDYEKIVFGHQ
SNVLYAARNANKFALIDTDYITTLAFCLTYEERDNPIVREFVQNYRFDLTILLENNVKWV
NDGLRSIGDDRRREKFQELLKRLYKEYDISCVTVKSSSYENRYLACKHIIKAYLDGKENL
QEIADSYE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataggtattgtcgtggggaaattttttccacttcatatagggcacgtaaat
ttaattcaaagagtgagtggaatagtggaaaaagtgtatgtagtagtttcatattcgacc
gatggagatgatttgattacttcaaattctaggtttgtgaaagaaataacaccaaaggac
agacttcgttttgtgaagcagacatttaagaatcagcctaatgtagcttcttttttgttt
aacgaagatgattgtccaccatatccagatggatgggaaaagtggtcaaaattgttaaaa
aaagaaatagaaaaaagagagaatttgtcaaatgaaaaaaatttagactggaaaaatgat
gtaatattcataagtaaccataaagacgatgaaaagtattatttaagatattttggctca
cagacaaagtcaattgacgaaaattataacgaatataatgtaaactcgcaggaaattagg
gaaaatccaagtaaatactgggattacttgcctcgtgaagtgagagagcatttaatccct
attataactatatgtggcggtgagagcagtggaaaaagcattatgattgataagctagcc
aatgtatttaatacgagttctgcatgggaatatgggcgtgaatacgtctttgagaaattg
ggaggagatgaagacgctctccaatactcagattatgagaaaatagtttttggacatcag
tcgaatgtcttgtacgcagcaagaaatgcaaataaatttgcgctgatagatacggattat
atcacaactttggcgttttgtctgacgtatgaagaaagagataatccgattgtcagagag
tttgtgcaaaattatagattcgatcttacaatacttttggaaaataatgtaaaatgggta
aatgatggactacgctcgattggagatgacagaagaagagaaaagtttcaagaattactt
aaaagattgtataaagaatacgatatttcgtgcgtaactgtaaaatcaagtagttatgaa
aacagatatttagcttgtaaacatattataaaagcatatttggacgggaaagaaaatttg
caagaaattgcggatagttatgaataa

DBGET integrated database retrieval system