KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_00239
Entry
lpa_00239         CDS       T01232                                 

Definition
(GenBank) hypothetical protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lpa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    lpa_00239
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpa02044]
    lpa_00239
Enzymes [BR:lpa01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     lpa_00239
Secretion system [BR:lpa02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   lpa_00239
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ADG23417
Position
195448..197337
AA seq 629 aa
MSMSKPNKSIGPQVRKKRVEKTNKQIVFLVVLALFVSMQIGTQFVAYKLHYHQSLGFSVA
HIYLPWQLLWWNLQYHSIYPDYFNAAFGLVAMSGSLFLMIILFVSKQLTQENVSEYLHGS
ARWANQDDLKDAGLIGNEEGVYVGAVENEKGDIHYLRHNGPEHILTYAPTRSGKGVGLVI
PTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPATLKGSARWNPLDEIRVGTE
YEVGDVQNLATLVVDPDGKGLETHWQKTSQALLVGFILHAIYKLKNQGEPATFPNIDRML
VDPNTNIADLLIEMTQYPHIDGKTHPVISASARDMIDRPEEEAGSVLSTLKSYLALYRDP
VVAHNVSASDFCIKDLMHHNNPVSLYIVTQPNDKARLQPLVRVMLNMVVRLLADRMEFER
VDDGKGNRFVRTKRNYKHRLLCMIDEFPSLGKLDILQESLAFVAGYGLKFYLICQDINQL
KSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKLTGQTTIVKEHITTSGKRVSTFLN
QISKTKQEVSRPLLTIDECQRMPGPKKDANGLITEAGDMVVYVAGFPAIYGKQPLYFKDP
VFIARASVESPEQSDILRTRLSEDEEIRL
NT seq 1890 nt   +upstreamnt  +downstreamnt
gtgagcatgagcaaacccaataaatccattggcccacaggtaagaaaaaagcgcgttgaa
aagacgaataaacaaatcgtttttttagttgtgctcgcgcttttcgtcagtatgcagatt
ggtacgcaattcgtggcttataaacttcattaccaccaaagcttaggattttcagtggcg
catatttatctgccatggcagctactttggtggaatctgcaataccattctatttacccg
gattattttaacgcggcctttggcctggtggcgatgagtggcagtctttttttaatgatc
attctttttgtcagtaagcaacttactcaagaaaacgtcagtgaatatctgcatggttca
gcccgatgggctaatcaagatgatttaaaagatgcaggtttgattggcaacgaggaaggc
gtttatgtgggtgccgttgaaaatgaaaaaggtgatattcattatttacgccataatggg
cctgaacatattttaacttatgcgccaacgcgctccggtaaaggtgtaggacttgttatt
cctactcttttatcctggaaacagtcttgtgtgattaccgatttaaaaggcgaactttgg
gcattaactgctggctggcggcaaaaacatgccaacaataaagtaatacgttttgagcca
gcgacattaaaaggttcagcgcgttggaatccgttggatgaaatcagagtcggtacggaa
tatgaagtcggtgatgtgcaaaatcttgcaacgcttgtggttgatccagacggtaaagga
ctcgaaacccattggcaaaaaacatcacaagcgcttttagtcggttttatcctccatgca
atttacaagctaaaaaatcagggagagccagccacatttcccaacattgacaggatgctg
gtagatcccaataccaatattgccgatttattgattgaaatgacccaatacccacatatt
gatggcaaaacacatcctgtgatcagcgcatcagcccgcgatatgatcgacaggcccgaa
gaagaagcaggctctgtattatcgactttaaaatcgtatctggccttataccgagatcca
gtcgtggcgcacaatgtttctgcctctgatttctgtattaaggatttgatgcatcataat
aatcctgtgagtctttatatcgtcacccaacccaatgataaagcacgattgcaaccattg
gttcgcgtcatgctgaatatggttgtccggcttttggcagatagaatggaatttgagcga
gttgatgatgggaaaggaaaccgatttgtaagaacgaaaagaaactataagcaccgtttg
ctgtgcatgattgatgaatttccaagtcttggcaaactggatattttgcaagagtcctta
gcatttgttgcaggttatggtttaaagttttatttaatctgtcaggacattaaccagctt
aaaagccgcgaaagaggctatgggccggatgaaacgatcacttctaactgccatattcaa
aatgcttatcctcccaaccggattgaaacggctgaacatctatcgaaattaaccggccaa
accactattgtcaaagagcacatcaccaccagcggcaagcgtgtttcaacctttttaaat
cagatttctaaaacaaaacaagaagtttctaggccgcttttaaccattgacgaatgtcag
cgtatgccagggcctaaaaaggatgctaatggcttaattactgaagcgggtgatatggtg
gtgtatgttgcaggttttcccgctatatatggaaaacaaccgctttatttcaaagatcca
gtgtttatcgccagagcttccgttgagtcacctgagcaatccgatatcttacgtactcgt
ctttctgaagatgaggaaatcaggctatga

DBGET integrated database retrieval system