KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_00808
Entry
lpa_00808         CDS       T01232                                 
Name
(GenBank) hypothetical protein
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
SSDB
Motif
Pfam: TrbH DUF5088
Other DBs
NCBI-ProteinID: ADG23838
Position
620314..620724
AA seq 136 aa
MKELSVLLFALLLSSCASQRYGNFTQVSQGRDVYLAQDAASQLTRVYPPAQNTFCISQKV
RDAFGISLIHEMRKKGYGVIENNCPKQKANFFYVVDEIKATNLYRVSLFIGSQTFSRIYA
KTGGKIPPVSAWTHKE
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaaggaactaagtgttttattgtttgctctattgctatcaagctgtgcaagtcagcgt
tatgggaattttactcaagtatctcaaggccgagacgtttatttggcacaagacgcggca
tcccaattaacacgtgtctatccacctgctcaaaatacgttttgcatcagtcaaaaggta
agggatgcttttggcatcagcctgattcatgaaatgcgaaaaaaaggttatggcgtgatt
gaaaacaattgccccaaacaaaaggccaattttttctatgttgtcgatgagattaaagca
accaacctttaccgagtcagcctttttattggctcacagaccttcagcagaatttatgcc
aaaaccggtggaaaaattcccccagttagcgcatggactcataaggagtga

DBGET integrated database retrieval system