KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_00853Help
Entry
lpa_00853         CDS       T01232                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa00020  Citrate cycle (TCA cycle)
lpa00640  Propanoate metabolism
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01120  Microbial metabolism in diverse environments
lpa01130  Biosynthesis of antibiotics
lpa01200  Carbon metabolism
Module
lpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpa_00853 (sucD)
   00640 Propanoate metabolism
    lpa_00853 (sucD)
   00660 C5-Branched dibasic acid metabolism
    lpa_00853 (sucD)
Enzymes [BR:lpa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     lpa_00853 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ADG23875
Position
660545..661420
Genome map
AA seq 291 aa AA seqDB search
MSVLVDKHTKVLCQGFTGKQGTYHTEQALAYGTKMVGGVTPGKGGQMHLGLPVFNTMREA
VEETQADASVIYVPAPFCKDSIIEAAEAGVKLIVCITEGVPVLDMLQVKVYIENNTQARL
IGPNCPGIITPGECKIGIMPGYIHLPGKVGIVSRSGTLTYEAVKQTTDKGFGQSTCIGIG
GDPIPGTSFIDALSLFEKDPKTEAIIMVGEIGGSAEEEAAEFIKSHVKKPVVSYIAGVTA
PAGKRMGHAGAIISGGKGTAAEKYAALEAAGVKTVRSPADLGDAIAEVTGW
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtattagttgataaacatacaaaagtactatgtcagggttttactggaaaacaa
ggtacttatcatacagagcaagcgctggcttatgggactaagatggtggggggagttact
ccaggtaagggtggtcaaatgcatctggggttgcctgtatttaatactatgcgtgaagca
gttgaggaaacccaggcggatgcaagcgttatctatgttcctgcaccattttgcaaagat
tccattattgaagcagcagaagcaggtgttaaactgattgtttgtattacagaaggtgtg
cctgtattggatatgttgcaagtaaaagtgtatatagaaaacaatacacaggctcgatta
attggtccaaattgcccaggaataattacaccaggcgaatgcaagataggtattatgcct
ggctatatccatttacccggaaaagttggaatcgtttcacgttcaggaactttaacctac
gaagcagtaaaacaaactactgataaagggtttggtcaaagtacttgcataggaataggt
ggcgatccaattccaggaaccagctttattgatgctttgtctttatttgaaaaagatcct
aaaacagaagctatcatcatggtaggagaaattggtggttcagcagaggaagaggcagct
gaattcattaagtctcatgtaaaaaaacctgtagtatcatacatcgctggagtcacagca
cctgctggaaagcgtatggggcatgctggagcaattatctctggtgggaaggggaccgca
gcagaaaaatatgctgctctggaagcggctggtgtgaaaacagttcgatctcctgctgac
ttgggagacgcaatagctgaggtaactggttggtaa

DBGET integrated database retrieval system