KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_00913Help
Entry
lpa_00913         CDS       T01232                                 

Gene name
pitA
Definition
(GenBank) inorganic phosphate transporter, PiT family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    lpa_00913 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADG23911
Position
complement(701363..702616)
Genome map
AA seq 417 aa AA seqDB search
MDYSIYLLFAALILCFLMTWGVGANDLANVMSTTMGSKAVTVRQAMLIAIIFEFAGAFLG
GEGVTETMRDGIINTSQLSNEPLILIEGMLCVLFACTIWMNLASYLGVPVSITNALVGSM
VGFGTIVLGPDAIHWNQVARIAIGWVSSPLISGITAYALFISIQQTIFVKSNPLTKAKLY
IPIYLFLIGFILSFITVFKGLNHFDIHLNLKQDLAVTLATSIIITILGMIFIKRIPEYHK
IRRRERFIQVEKYFAVLMAMTACAMAFAHGSNDVALAVGPLSIVHSLVMHSNQIFDADNY
PSWIILLGCVGVVTGFLMYGRKVIETVGSSITALTPSRAFAATLSAATTVVVATSTGIPV
SATQTLVGAVLGVGLARGIGALNLIVIRNIFMSWVLTLPAASMLTILSYKLLHALLG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggattattcaatttacctactttttgctgctcttattctttgttttcttatgacctgg
ggggtcggtgccaatgatttggctaatgtcatgagtaccactatgggctcaaaggcagtt
accgtccgtcaagccatgcttatcgccatcattttcgaatttgcaggcgcttttttaggg
ggcgaaggtgtcactgaaaccatgcgtgatgggattatcaataccagtcaactttctaat
gaacctttaatcctcatcgaaggcatgctatgcgttttgtttgcctgcacaatatggatg
aatcttgcgagttatctgggggtccctgtttcgataaccaacgcattagtaggctccatg
gttggttttggcactatagtcttgggtcctgacgcaatacattggaaccaggtagcgcga
atcgctattggatgggtttcatctccgttgatttcagggattacggcctacgcattgttc
attagtatacagcaaaccatatttgtaaaaagtaacccgttgactaaagccaagctatat
attcctatttatctttttttgattggttttatattatcttttatcactgtatttaaagga
cttaaccattttgatattcacttgaatttaaagcaagatttggcggtgactctggccacc
agtataataattactattctgggtatgatctttattaagcgtattcctgaataccataaa
ataagacgcagggaacgatttattcaggtagagaagtattttgctgtgctcatggcaatg
acggcatgcgctatggctttcgctcatggctccaacgatgttgccttggcagttggacca
ttaagtattgtgcacagcctggtcatgcattccaatcaaatatttgacgcagataattac
ccttcctggattattttattaggctgcgtcggagtagtaactggtttccttatgtatgga
agaaaagtcattgaaaccgtaggaagttctatcactgctttaactcccagccgtgcattt
gctgcaacactttctgcagcaactaccgtagttgttgcaaccagcaccggaatccctgtt
tcggcgactcaaactttggttggtgccgttttaggtgtaggtttggcaagaggtatcggc
gctttgaatctcattgtaatccgtaatatctttatgtcatgggtactgacattacctgca
gcctccatgctaacgatcttatcctataaacttttacatgctttgttgggataa

DBGET integrated database retrieval system