KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_01507
Entry
lpa_01507         CDS       T01232                                 
Symbol
virB4
Name
(GenBank) Type IV secretory pathway, VirB4 component
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
SSDB
Motif
Pfam: TraC_F_IV DUF87 P-loop_TraG AAA_10 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ADG24334
Position
complement(1192348..1195098)
AA seq 916 aa
MKRLSNWLLGEMNPQAIKELTIKKQYANPLPSFADRLAIVDFNEQEQVFLFADGKSLGSG
FELGDIQAEAASPEYLHAVFNKIRDTFATVVPLHAIDPWVMQMFVQDEYCLDPVIDHIKA
QIPQQFIESSLTQDYLQRLQDLYNKMTRPEGLFLDPKTGAPYRGRRRRIRVLFYRQLHQT
TLTREQILLEHQEVISQIETKLRSPGLEIKRLKGQDYYQWWIRWFNPKSADEILEQYPYP
NHIPAGFNLAQNIFFSPPESDEQGFIFEGRKQRILYVDGLKEAPIIGLVSRERQQANPKH
RYALLDTLPEGSIYTIQVVFSHDENLDSHLTRLEKGIVGTSLKPQEVRDDIKTARNELSI
GNRLFWVNQAVFYQAEDEKQAQAIEKNLHTIFNDAKMPLIHSSYDIHPLNSWLNALPFNF
DPRYARKYLCFDRLMYATELAALLPVYGRNQGARHLPCFPFFNRLGEPVFFDLLHHDFIS
QNSHCAIFANSGGGKSVLTGWMIQSLLAMKNARVVLFEMGNSFDRMLVHAKAHGKKTKQL
LLSNKKEEAVPLNPFCEAYKAIPEITDNLSAEQAALIAQKIMDLKDPAHSEDLACGVGSR
AYLAELALALRTMITEANSMEEEQFTLADETLLIEVLIDAILTSFNEGIPQMLTEHIVSA
FQRRLDKETVTRKKDRILDMHDRLNSYVINSAKSRFFNVPTEPLGDFDIFHIDISAIKDD
TGKLALVMVSLLPRILAMAEATQNDNRPTFLFIDESHLQFQIPSVVTVCLLVAKVARKLG
LWLVAITQNVTDMNSEKAAKILSLIETWILLGLDEKEITDVKRFKSLTPQQETLIRDIDS
QKGLYAEAVLLGSRYQGLFRVIPPRYLLALLMTEKSEKAQRHLLEKEHDVLEAAEIMAKK
LEQPKTTTHNRAYFYD
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgaaacgattatctaactggttgcttggggaaatgaatccccaggctataaaagaacta
accattaaaaagcaatacgccaatcctttgccctcgtttgctgacaggctggccattgtt
gatttcaacgaacaagaacaagtgtttttatttgctgatggaaaaagtttaggttcaggg
tttgagctaggtgatattcaagccgaagcagcttctcctgaatacttgcacgctgtcttt
aataaaatccgcgatacctttgcaacagtggttccactacatgcaatagacccttgggtt
atgcaaatgtttgttcaagacgaatattgccttgatccggttatcgatcatattaaagcc
caaattccacaacagtttattgaaagctcattaacgcaagattacttacaacgcctgcaa
gatctctacaacaaaatgaccaggccagaaggtttatttctcgatcctaaaacaggtgcg
ccctatcgaggacgaagacgacgaatcagagtattgttttatagacaactacatcaaacc
actttaaccagagaacaaattcttctcgaacatcaagaagtcatcagtcagattgaaacc
aaactacgctcaccgggtttagaaatcaaacgccttaaaggtcaagattattatcagtgg
tggatacgctggtttaatcctaaatcagccgatgagatcttggaacaatatccctaccct
aatcacatacccgcaggttttaatctggcacaaaatatattcttttcaccgcctgagagt
gacgaacaaggatttatttttgaaggccgaaaacaaagaatcctgtatgttgatggctta
aaagaagcacccattattggtttagtctcccgagaaagacaacaagccaatcctaagcac
cgatatgcgcttttagatactttgccagaaggaagcatctacactattcaagtcgtcttt
agccatgatgaaaatcttgattcccatttaacacgattagaaaagggaattgtgggaacc
agcctaaaaccccaagaggtcagagatgatataaaaacagcccgtaatgaattaagtatt
ggcaatcgtttattctgggttaatcaggccgttttttatcaagcagaggatgaaaaacaa
gcacaagccatagaaaaaaacctgcataccattttcaacgatgcaaagatgcccttaatt
cattccagctatgatatccaccctttaaattcctggctcaatgccttgccgtttaatttc
gatccccgctatgcccgtaagtacttatgctttgaccgtctgatgtatgccacggaactt
gcagcattgcttccagtttatggccgaaaccaaggggcaaggcatctaccctgctttcct
tttttcaaccgcttaggcgaacctgtattctttgacttgttacatcatgattttattagc
cagaattcacattgcgccatcttcgctaactctggtggtggtaagtcagttttaacaggt
tggatgattcaatcattactcgccatgaaaaacgcccgtgtagtactttttgaaatgggg
aactcgtttgatcggatgctcgttcatgccaaagcccatggtaagaaaaccaagcaatta
ttattaagcaataaaaaagaagaagctgttccattaaatccattttgtgaagcgtataaa
gcaattccagaaataacagataatttaagcgcagaacaagctgctttaatagctcaaaaa
atcatggatcttaaagatcctgctcactcagaagatttagcttgtggtgttggttctcgt
gcataccttgcagagcttgctttagctttgcgtactatgattaccgaagccaattccatg
gaagaagaacaatttaccctagctgatgaaacgctgctaatcgaagtattaattgatgcc
attctaacgtcatttaacgagggcataccacaaatgctgacagagcatattgtgagtgca
tttcaacggcgattagataaagaaactgtgacgcgcaagaaagatcggattctggatatg
cacgaccgattaaacagttatgtcattaacagcgccaaatcacgcttttttaatgtacca
acagaacctttaggtgattttgatatctttcatattgatatttctgccattaaagatgat
accggaaaactggctttggtcatggtgtctttgttgccaagaatactggctatggcagaa
gccactcaaaacgacaataggccgacctttctttttattgatgaatcccatctgcaattt
caaattccctctgtggtgactgtgtgtctattagttgccaaagtagccagaaaactcggg
ctttggctggttgcaattacccaaaatgtcaccgacatgaattctgaaaaggctgcaaag
attttatcgttaattgaaacctggattttattgggattggatgaaaaagaaatcactgat
gtgaaacgtttcaaatccttaacaccacagcaggaaaccttaatcagagatattgattca
caaaaaggtttgtatgcagaagcggttttattagggtcgcgctatcaaggattgtttcgc
gtcattccacctcgctacctgcttgcccttttaatgactgagaaatcagaaaaagcacaa
cgccacctcctggagaaagaacatgatgtccttgaagcagctgaaatcatggctaagaaa
ctcgagcaaccaaaaacgactactcataacagggcttatttttatgactaa

DBGET integrated database retrieval system