KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_01518
Entry
lpa_01518         CDS       T01232                                 

Definition
(GenBank) hypothetical protein
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
SSDB
Motif
Pfam: DUF3487 PrgI DUF4752 DUF3040
Other DBs
NCBI-ProteinID: ADG24340
Position
complement(1198080..1198442)
AA seq 120 aa
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIG
FIFSITVWPKGVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagtcagccttcttcgcgccatctatcacatgactttccagcctggaaaggcttaagt
ctgcgtgaattgttttggattgtcatcactacaacaccagtaactaccttgctttttatt
cttttaggaacaatggcagggtatccactagccgctggctgcatcggttttgtgattgga
ttcatcttctccattaccgtatggccaaaaggagtcgcccgtatcaaagcaggcaaacct
tatggttatgtgatgaagaaaaccattcaatggatggtgcgattaaggctcaaacactcg
ccctggattcattatcaggggcagtggcaaaagaataaatctgttggagagcctcatgtt
tga

DBGET integrated database retrieval system