KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_01522
Entry
lpa_01522         CDS       T01232                                 

Definition
(GenBank) hypothetical protein
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
SSDB
Motif
Pfam: Plasmid_RAQPRD Uteroglobin ApbA_C
Other DBs
NCBI-ProteinID: ADG24343
Position
complement(1199082..1199408)
AA seq 108 aa
MKRLLCLTLIMISLQCSANNPDLNETLVRIINQINAIMPLLDEAQTQVTPNARIQLQIEG
FEDLQGQHHSGLREDLLNIRNGLIDYINQPIIAPRKIKPLEMDFVRKP
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaaacgattgctttgtttgaccttgataatgataagccttcaatgctcagcaaataac
cctgatttaaatgaaactttggtgcgcatcattaatcagattaacgccatcatgcctttg
cttgatgaagcgcaaacacaagtaacacctaatgctcgtatccaattgcaaatagaagga
tttgaagacctccaaggccagcatcactccggattgagagaagacttgctaaatatccgc
aacggcctgattgactacatcaaccagcccatcattgcccctcgaaaaattaaaccatta
gaaatggattttgtgaggaaaccttaa

DBGET integrated database retrieval system