KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_02637Help
Entry
lpa_02637         CDS       T01232                                 

Gene name
paaJ
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa00071  Fatty acid degradation
lpa00072  Synthesis and degradation of ketone bodies
lpa00280  Valine, leucine and isoleucine degradation
lpa00310  Lysine degradation
lpa00362  Benzoate degradation
lpa00380  Tryptophan metabolism
lpa00620  Pyruvate metabolism
lpa00630  Glyoxylate and dicarboxylate metabolism
lpa00640  Propanoate metabolism
lpa00650  Butanoate metabolism
lpa00900  Terpenoid backbone biosynthesis
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01120  Microbial metabolism in diverse environments
lpa01130  Biosynthesis of antibiotics
lpa01200  Carbon metabolism
lpa01212  Fatty acid metabolism
lpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lpa_02637 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    lpa_02637 (paaJ)
   00640 Propanoate metabolism
    lpa_02637 (paaJ)
   00650 Butanoate metabolism
    lpa_02637 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lpa_02637 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    lpa_02637 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpa_02637 (paaJ)
   00310 Lysine degradation
    lpa_02637 (paaJ)
   00380 Tryptophan metabolism
    lpa_02637 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lpa_02637 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lpa_02637 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lpa_02637 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpa04147]
    lpa_02637 (paaJ)
Enzymes [BR:lpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lpa_02637 (paaJ)
Exosome [BR:lpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpa_02637 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADG25166
Position
2118466..2119650
Genome map
AA seq 394 aa AA seqDB search
MEHNDVVIVAAKRTPMGAMLGNLSALSSPELGAVAHMAALSQSGIAPAEIDEVISGCVLQ
AGIGQAPARQAAIKAGIPNSTGATTINKMCGSGMKAVMLAHDLIKAGTANVILASGMESM
SNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYDKGQLMGCFAETTAKHFNFSREQQDE
YALRSMTKALKAIENGAFREEIAPVTLTTRKGDITVDVDEGPETAKLAKIPQLKPAFQAD
GTVTAANSSSISDGAASLILMSASNAEKRGIKPLAKIIAHASHSQAPQWFTTAPVDAIRK
VMNKASWKQDDVDLFEINEAFAVVAMAAITQLELNPEQVNIHGGACALGHPIGASGARIL
VTLMHALKHQGKKRGIASLCIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatgatgtcgtgatagtcgcagcaaaaagaacaccaatgggagctatgcta
ggcaatttatctgcactttcctccccagagttaggggcagtagcgcatatggcagcgttg
tctcaatcaggtattgctccggcagaaatcgatgaagtgatcagtggttgtgtattacaa
gctggtattggtcaagctcctgccagacaggcagcaataaaagcaggcatacctaattcg
acaggagccacgaccattaataaaatgtgtggttcgggcatgaaggctgtgatgcttgcg
catgatttaattaaggcaggtacagctaatgtaattttggctagcggtatggaaagtatg
agcaatgccccctatttattatccaaagcacgagcaggatatagactgggtcatggtgaa
ctgaaagatcatatgttccttgatggattagaagatgcctatgataaaggacaattaatg
gggtgtttcgctgaaacaactgcaaaacactttaatttcagcagagaacaacaagacgaa
tatgccttacgctcaatgaccaaagcgctaaaagcaatagagaatggtgcctttcgagaa
gaaatcgctcctgtcaccttaactacccgcaaaggagatatcacggttgacgtcgatgaa
gggcctgagacagccaaacttgccaaaatacctcagttaaaaccagcctttcaagcagat
ggtacagtcacagcagccaattcaagttctatttcagatggcgcggccagtttaatttta
atgagtgcctcaaacgcagaaaaacgtggcattaagcccttggcaaaaatcatagcacat
gccagccattcccaagccccacaatggttcacaaccgctcctgttgatgcaatccgtaag
gtaatgaacaaagcgtcatggaaacaagatgatgtggatctttttgagattaatgaagcg
tttgcagtagtagcgatggcagcaattactcagcttgaattgaacccggaacaagtcaat
atacatggcggggcatgcgctttagggcatcccattggtgcttcgggagctcgcattctg
gttactttaatgcatgcgctaaaacaccagggtaaaaaacgcggaatagcttctttatgt
ataggcggtggtgaagcaacagctatggcaattgagctaatttaa

DBGET integrated database retrieval system