KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_03204Help
Entry
lpa_03204         CDS       T01232                                 

Definition
(GenBank) acyl CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa00061  Fatty acid biosynthesis
lpa00071  Fatty acid degradation
lpa01100  Metabolic pathways
lpa01212  Fatty acid metabolism
lpa02024  Quorum sensing
Module
lpa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:lpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    lpa_03204
   00071 Fatty acid degradation
    lpa_03204
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    lpa_03204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lpa01004]
    lpa_03204
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpa04147]
    lpa_03204
Enzymes [BR:lpa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     lpa_03204
Lipid biosynthesis proteins [BR:lpa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   lpa_03204
Exosome [BR:lpa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   lpa_03204
  Exosomal proteins of breast cancer cells
   lpa_03204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADG25567
Position
2611841..2613220
Genome map
AA seq 459 aa AA seqDB search
MLFLASDVPNKVAITQDNRAITFDELTHEVLANSKQLLKLPKTIIVLHATPEIGFIIQLL
ACLETGRPIALFPNSISEEEKQRRLSLLGNAVMINEEGELQEICENKTIQPHPQTALILF
TSGSTGSVKAVQLSSINIIANCHAVIKALEFKKVQDQLLFLPLSYSFGLLGQLLPGLMFG
LSTRLISHFTDIKMLMEQGTVPQMWSGVPSHWVAINAIAKRYPDSAAKINAIVSAGAPLS
TTLRADLKQIFPNAIIYNNYGLTEASPRVLTYSSKDPLFTENYAGYPVGDWKVKLSAEHE
LLISGTQMMLGYLGEKDSTKIQNGWLSTGDIAEILPNGLVAIKGRRDSLVNIGGEKVNLS
EIEQTICQIDVIKEAIVIPQEDKIYGTRLIVCIEKKSLPSSISEQNLIEKIQTHLLPRKL
PIQLQLMSSLPRNQHGKLDRKALVLNIGGLDNKEKNNAK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttttggcatcagatgttccaaacaaagtagcaattacccaggacaatcgagca
ataacttttgatgaattaacgcatgaagttttagcaaattcaaagcaactcctgaaactt
ccaaaaaccatcattgtcctccatgcaacacctgagattggatttattattcaactatta
gcctgtttggaaactggtcgccccattgccctttttcccaattccatttcagaggaagaa
aagcaaagacgactgtctcttttgggtaatgccgtaatgataaatgaagaaggggaattg
caggaaatatgtgaaaataaaacgatccagccccatccccagacagcacttattctcttc
acctcaggaagcacaggatcagtaaaagcagttcaactatcaagcatcaacataatagcc
aactgccatgcggtcataaaggcgctggaatttaaaaaagttcaagatcaattgctcttt
ttacctttatcctattcttttggccttctgggccaattgctccctggtttaatgtttggc
cttagcacccgactaatctctcattttacagacattaaaatgctaatggagcaaggtacc
gttcctcagatgtggagtggcgtaccttctcactgggtagctatcaatgccatagcaaaa
cgataccctgatagcgcagccaaaattaacgcgattgtttctgctggcgctcctttatcc
actacactcagagcggatttgaaacaaatatttcctaacgctatcatctataacaattac
ggcttaactgaagcgtctcctagagtgctgacttattccagtaaggatcctttattcaca
gaaaattacgcaggttatcctgttggcgattggaaggtcaaactttctgctgaacatgaa
ttattaattagcggcactcaaatgatgctgggttatcttggtgaaaaagatagtactaaa
atacaaaatggctggttatcaacaggagatattgcagaaatattacccaatgggttagtt
gcaatcaaaggacgtcgagacagtcttgttaatattggaggagaaaaggttaacctctct
gagatcgagcaaacaatttgccaaattgatgtaataaaagaggccattgttatccctcag
gaagacaagatatatgggacacgattaattgtctgtatcgaaaaaaaatcgctgccttct
tccatttctgaacaaaatttaatagaaaaaatacaaacgcatctactacccaggaaattg
cccattcaattacagctcatgtcatccctacccagaaatcaacatgggaagcttgataga
aaagcgttggttttgaatattggcggtttagataataaggaaaaaaataatgctaagtaa

DBGET integrated database retrieval system