KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_03993Help
Entry
lpa_03993         CDS       T01232                                 

Gene name
hemD
Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa00860  Porphyrin and chlorophyll metabolism
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lpa_03993 (hemD)
Enzymes [BR:lpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     lpa_03993 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADG26137
Position
3200067..3200819
Genome map
AA seq 250 aa AA seqDB search
MTKSLNGLRILNTRPREQAQVLNKKIIESGGIPIDCPTMEIMASENNWINNLPDLTLVNQ
AIFVSANAVRYFMMELASKSINWPNSIRVAAIGKGTSRVLNEFNIQVSDIPELPDSEHLL
TLNSLQQIRNQTILLVKGEGGRQLIEEYLMLKGAKLCLLSVYKRVMPTIDKEFLNSLWRD
DLADIILLTSEQSIHNLFKMFSIEGQMWLQNKPCLVISDRLAKVASLFGIKKILISHPER
MIGTLFDYKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatcacttaatggtcttcgcatattaaacaccagacccagggagcaagcacaa
gtacttaataaaaaaattatcgagtctggtggaatacccatcgactgccccacgatggaa
ataatggcatctgagaacaattggataaataatttgcctgatttgaccttagtaaatcag
gccatttttgtcagtgcaaatgcagttcgttatttcatgatggaactggcttccaaaagc
atcaattggccaaatagcatccgggtagctgctataggtaaaggcacctccagagtactc
aatgaattcaatatccaggttagtgatatccccgaattacctgacagcgagcatttactg
actctcaattcattgcaacaaataagaaatcagacgattctgcttgtgaaaggagaagga
ggcaggcaactgattgaagaatatttaatgctgaagggagcgaagctatgtcttctgtca
gtctataaacgagtcatgccaaccatcgacaaagaatttcttaattctctgtggcgcgat
gacctggcggacattatactgttaacaagtgagcagtccatacataatctttttaaaatg
tttagcatagaggggcaaatgtggttacaaaacaaaccttgcctggtcattagtgaccga
cttgcaaaggtagcttctttatttggaattaaaaagattcttattagccatccagaaagg
atgataggtacgttatttgactataaggattaa

DBGET integrated database retrieval system