KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_04034Help
Entry
lpa_04034         CDS       T01232                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa00790  Folate biosynthesis
lpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpa_04034 (folE)
Enzymes [BR:lpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     lpa_04034 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ADG26159
Position
3229368..3229907
Genome map
AA seq 179 aa AA seqDB search
MEKLYSNLLKELGEDINREGLKDTPGRAANALRYLTKGYNENLDEIINGALFDSDMSEMV
IVKDIELYSLCEHHLLPFLGKCHVGYLPDGKVIGLSKIARIVDFYARRLQIQERLTGEIA
HCIESITGARGVAVVIEAKHLCMMMRGVEKQNSVMTTSVMLGEMRNNSSCRLEFLNLIR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatactcaaatttgcttaaagaattaggcgaagatataaatcgggaagga
ttaaaggatactcctggacgagcagctaatgccttacgttatttaactaaaggttacaat
gagaaccttgatgaaatcattaacggtgctctgtttgattcagacatgagtgaaatggtt
atcgtcaaggacatagaactgtactcattatgcgaacatcacttattgccttttttgggc
aaatgtcatgttggatatctacctgatggtaaagtaataggcttatctaaaattgctcgt
attgttgatttttatgcgaggagactacaaattcaagaacggctgactggcgaaattgct
cattgtattgaatccattaccggagctcgcggtgtcgccgtagtgattgaagcaaaacat
ctttgcatgatgatgcgtggagttgaaaaacaaaattctgtcatgacaacttcagtgatg
ctcggtgaaatgcgtaacaattcgagttgccgtttggaattcttaaatttaatccgttaa

DBGET integrated database retrieval system