KEGG   Leishmania panamensis: LPMP_322450
Entry
LPMP_322450       CDS       T06539                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lpan  Leishmania panamensis
Pathway
lpan00100  Steroid biosynthesis
lpan01100  Metabolic pathways
lpan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    LPMP_322450
Enzymes [BR:lpan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     LPMP_322450
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 22577986
NCBI-ProteinID: XP_010701931
UniProt: A0A088RYW9
Position
32
AA seq 437 aa
MAKGSGAASKSVGNLLQPRTTTYEWGGPVGGFFMVLFLPTLVMALNSLCAGEQCGITQAM
RLPALMTELVRGAWPMVPKAIGIELVWLAAHAVFSILPIGRLVHGGELRNGERLAYRMNA
IHAFIISHVVLLGLHYTSIVSMAVVADLFHPLMIGAIFISFAMSVVLYAASFRRRNVLTA
LGGNSGNALYDFWIGRELNPRTGPLDWKLMCELRPGLIGWSIMNWAFVCKSVELGTVTPS
IVLTALFESFYVLDGLLLEAGNLTMMDIVTDGFGFMLCFGDLAWLPFTYTLQTKYLVHHP
AHLSPLHLCLCASLSVAGYVIFRGANTEKDRFRSNPKDPCVQHLHVMKTSKGKSLIISGY
WGMCRHPNYVGDWLMALGWAAFSGTAELLPYFHPIYFGFLLMHRQLRDEQQMREKYGRED
WNAFCRIVKYRLIPYLY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcgaaagggagcggtgccgcttccaagtcggtgggaaatcttctgcagccccgcacg
accacctacgagtggggcggcccggttggtggcttcttcatggttctcttcctccccaca
ttggttatggcgctgaacagcctctgcgctggggagcagtgcggcatcacgcaggcaatg
cggctgcctgcactgatgacggagttggtgcgcggtgcgtggccgatggtaccgaaggcg
atcggcattgagcttgtgtggctcgctgcccacgctgtattttctatcctccctattggc
aggctcgtccacggtggcgagctccgcaacggcgagcgacttgcctaccgcatgaacgcc
atccacgccttcatcatctctcacgtcgtgcttcttggcttacactacacctctatcgtg
agcatggccgttgtggccgacctcttccaccccctcatgatcggtgccattttcatctcc
tttgctatgtcggtcgtgctgtacgcggcatcgttccgccgtcgcaacgtactcacagct
cttggtggcaacagcgggaacgccctgtacgacttttggatcggccgcgagctgaacccg
cgcaccggtccgctggactggaagctgatgtgtgagctgcgtcctggtctcattggctgg
agcattatgaactgggcatttgtctgcaagtcggtcgagctgggcaccgtgacgccaagc
atcgtgctcaccgcactcttcgaatccttctacgtgctggacggcctgctgctggaggcg
ggaaatctcaccatgatggacattgtgacggatggctttggcttcatgctgtgctttggt
gaccttgcgtggttaccgttcacgtacacgctgcagacaaagtacctcgttcaccacccc
gcgcacctctcgcccttgcatctgtgcctctgcgcctccctttctgttgccggctacgta
atctttcgtggcgccaacacggaaaaggaccgcttccgcagcaacccgaaagacccgtgt
gttcagcacctgcacgtcatgaagacctccaagggtaagtctctcatcatctccgggtac
tggggcatgtgccggcacccaaactacgtcggtgactggctgatggcgctcggctgggcg
gcgttcagcggcaccgcggagctgctgccatacttccatcccatttactttggtttcctt
ctcatgcaccgccagctgcgtgatgaacaacagatgcgggagaagtacggtagggaagac
tggaacgcgttctgccgcatcgtcaagtaccggcttatcccgtacctctactag

DBGET integrated database retrieval system