KEGG   Lactobacillus paracasei subsp. paracasei JCM 8130: LBPC_0278Help
Entry
LBPC_0278         CDS       T04768                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lpap  Lactobacillus paracasei subsp. paracasei JCM 8130
Pathway
lpap00520  Amino sugar and nucleotide sugar metabolism
lpap01100  Metabolic pathways
lpap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LBPC_0278
Enzymes [BR:lpap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LBPC_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: BAN70574
Position
292706..293866
Genome map
AA seq 386 aa AA seqDB search
MSYYIHAAKFFLKNVTEIGGYLEVTDDGKFGEYLPETAKPDGDIVEQSGKLIAPGLVDTH
IHGLLGHDVMDNDWDGIETMSKNLLKAGVTSWLPTTLTGSFDQLNEVCKTIAAHAGDESG
AKIQGIYFEGPYFTTKHKGAQNPKYFKNPSEQEYDAWQTSADGLLKKIAIAPEREGAADF
TRYATADGTVVALGHSDATFEQAKACIEAGATVFTHTFNGMSPLSHREPGMVGAAMYLQG
VDDELICDGHHVRPEVATTLIRLKGAEHIALITDCMRAGMMPDGDYVLGEFPVYVKDGMA
RMKDGDSLAGSVLELKDALTNLLAWNAATPEAIIRMASQTPAASCNIDDQCGSILPGRAA
DYLVLDADLKLEATYLDGKLGYQAEA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagttactacattcacgctgcaaagttttttctcaagaatgtgactgaaattggtggt
tatctagaagtcaccgatgatggcaagtttggcgagtatctgccggaaacagctaagcca
gatggcgatattgttgaacaatccggcaaattgattgctccaggtttagttgatacccat
attcacgggttgttagggcatgacgtaatggacaacgattgggatggcattgagacaatg
agcaagaacttgctcaaagctggtgtcaccagttggctgccaaccacattgaccggttca
tttgatcaactcaatgaggtttgcaaaacgattgccgcacatgctggcgatgaaagcggt
gcgaagattcaaggcatttattttgaaggcccatactttacaaccaagcataaaggggca
cagaatccgaagtacttcaaaaatccaagtgagcaagaatacgatgcttggcagacgtcc
gctgatggcttgttgaagaaaattgcgattgccccagaacgtgagggtgctgctgacttc
actcggtatgccaccgcagacggcacggtggtggctttgggccatagtgatgccaccttt
gagcaggctaaagcttgtatcgaagccggtgcaaccgtcttcacacacactttcaatggt
atgagtcctttgagccatcgcgaacctggtatggtcggagcagcgatgtatctgcaaggg
gttgatgatgagcttatctgtgatggtcatcatgtccgtcctgaagtggccaccaccttg
attcgactgaaaggcgctgaacatatcgcattgattaccgattgcatgcgtgcggggatg
atgcctgatggcgattacgtccttggcgaattcccagtttatgtcaaagacgggatggcg
cggatgaaagatggcgacagtctggcgggttcagttcttgaattgaaagatgcgttgacc
aatctccttgcttggaacgccgcaacaccagaagcaattattcgaatggcttctcaaaca
ccggctgcttcttgcaatatcgacgatcaatgcggcagtattttacctggccgagccgct
gattatctagttttggacgctgatctcaagctcgaagccacctatcttgatggcaaatta
ggctatcaagctgaagcatga

DBGET integrated database retrieval system