KEGG   Lactobacillus paracasei subsp. paracasei JCM 8130: LBPC_1649Help
Entry
LBPC_1649         CDS       T04768                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
lpap  Lactobacillus paracasei subsp. paracasei JCM 8130
Pathway
lpap00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lpap00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBPC_1649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpap01007]
    LBPC_1649
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpap03016]
    LBPC_1649
   03029 Mitochondrial biogenesis [BR:lpap03029]
    LBPC_1649
Enzymes [BR:lpap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     LBPC_1649
Amino acid related enzymes [BR:lpap01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   LBPC_1649
Transfer RNA biogenesis [BR:lpap03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LBPC_1649
 Prokaryotic Type
   Other AARSs
    LBPC_1649
Mitochondrial biogenesis [BR:lpap03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LBPC_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N
Motif
Other DBs
NCBI-ProteinID: BAN71945
Position
complement(1732853..1734535)
Genome map
AA seq 560 aa AA seqDB search
MDFKELVVKALEPALAGQLDAAAIKSLIETPKSSDLGDYAFPTFSLAKIMHRAPKMIASD
LVGQIDVTPFEKVKAVGGYVNFYLDKISFAHDVLKVIAQAGEHYGDANIGSGNVPIDMSS
PNIAKPMSMGHLRSTVIGNALANILSKIGYTPIKINHLGDWGTQFGKLIVAYKKWGSEDA
VKADPIKNLLHYYVEFHEKAEANPELGDEARAWFKRLEDGDEEAIALWRWFRTVSLAEFN
RIYKILGVDFDSYNGEAFYNDKMADVVKRLEDKHLLKTSQGAEIVDLSAYNLNPALIKKS
DGATLYMTRDLAAAIFRKEHYHFVQSLYVVGNEQREHFQQLKAVLLEMGYDWANDIHHIP
FGLITANGKKLSTRKGNIILLENVLRDAVGLAKQQIAEKHPDLPNADKVAHEVGVGAVIF
HDLKNERLDNFDFNLEEVVRFEGETGPYVQYTNARANSILRKAAIDPAPEVALSDPAAWD
VLRALGDYPSMVLRAAKEYEPSVIAKYALRLAKAFNKYYANVKVLVEDSELPARLAMVKA
TTQVLTNALQLLGVGAPEEM
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggattttaaagaacttgttgttaaggcacttgaaccagcacttgccggtcaattagac
gcggctgcgatcaagtccttgattgaaacacccaaatcatcagacttaggagattatgct
tttccaaccttttccttggcgaagatcatgcatcgcgcaccaaagatgattgcgagcgat
ttggtcggtcaaattgatgtgaccccgtttgaaaaagtgaaggctgttggtggctatgtt
aacttttatctggataaaatcagttttgcccacgatgtgttgaaagtgatcgcgcaagct
ggcgagcattatggtgatgctaatatcggcagcgggaatgtaccgatcgacatgagcagc
ccgaacattgctaaaccaatgtccatggggcacttacgctcaaccgtgattggcaatgcc
ttagccaacattctcagcaaaatcgggtatacaccgattaaaattaatcaccttggcgac
tggggcacacaatttggtaaactgattgtggcgtacaagaagtggggatccgaggacgct
gtcaaagccgatccgatcaaaaatctattgcattactatgtggaatttcatgagaaggcc
gaggcaaatcccgagttgggcgatgaggcccgtgcttggtttaagcggctggaagatggc
gatgaagaagccattgcgctttggcgctggttccgcacagtttcactggctgagttcaat
cgaatttacaaaattctcggtgttgattttgattcttacaatggcgaagccttttataat
gacaaaatggctgatgtggtgaagcggcttgaagacaagcatttgctgaaaactagtcaa
ggtgccgaaattgtggatttgagtgcgtataacttgaatccagcgctgatcaagaagtca
gatggcgcaacgctgtatatgacgcgtgatctcgctgctgcgattttccggaaagaacat
tatcattttgttcaaagcctgtacgttgttggtaatgaacaacgcgaacacttccagcag
ttaaaagccgtcttgttagaaatgggttacgactgggcgaatgatattcaccacattcca
tttgggctgattacggcgaatggcaagaagttgtcaacgcgtaaaggcaacattatctta
ctggaaaatgttttgcgcgatgctgtcggtctggcgaaacaacaaattgctgaaaagcat
cccgatttaccaaatgcggataaagttgcgcatgaagtcggtgtcggcgccgtcattttc
catgacttgaagaacgaacgcttagacaacttcgacttcaacttagaagaagtcgtgcgt
tttgaaggtgaaactggtccatatgtacagtacacgaacgcgcgggctaatagcattttg
cggaaggctgcgattgacccggcgcctgaagtggctttaagtgatccagcggcttgggac
gttttgcgcgcccttggcgattacccaagcatggtcttgcgtgcagccaaggaatatgaa
ccttctgtgattgctaagtatgcactacgcttggcaaaagctttcaataagtattatgcc
aatgtcaaagtgctggttgaggacagtgagctgccagctcgattggcgatggttaaggcg
acgacacaagtgctaacaaatgcgctgcaactgttgggtgtcggtgcgccagaagaaatg
taa

DBGET integrated database retrieval system