KEGG   Lactobacillus paracasei subsp. paracasei JCM 8130: LBPC_1703Help
Entry
LBPC_1703         CDS       T04768                                 

Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpap  Lactobacillus paracasei subsp. paracasei JCM 8130
Pathway
lpap00071  Fatty acid degradation
lpap00072  Synthesis and degradation of ketone bodies
lpap00280  Valine, leucine and isoleucine degradation
lpap00310  Lysine degradation
lpap00362  Benzoate degradation
lpap00380  Tryptophan metabolism
lpap00620  Pyruvate metabolism
lpap00630  Glyoxylate and dicarboxylate metabolism
lpap00640  Propanoate metabolism
lpap00650  Butanoate metabolism
lpap00900  Terpenoid backbone biosynthesis
lpap01100  Metabolic pathways
lpap01110  Biosynthesis of secondary metabolites
lpap01120  Microbial metabolism in diverse environments
lpap01130  Biosynthesis of antibiotics
lpap01200  Carbon metabolism
lpap01212  Fatty acid metabolism
lpap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpap00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBPC_1703
   00630 Glyoxylate and dicarboxylate metabolism
    LBPC_1703
   00640 Propanoate metabolism
    LBPC_1703
   00650 Butanoate metabolism
    LBPC_1703
  Lipid metabolism
   00071 Fatty acid degradation
    LBPC_1703
   00072 Synthesis and degradation of ketone bodies
    LBPC_1703
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBPC_1703
   00310 Lysine degradation
    LBPC_1703
   00380 Tryptophan metabolism
    LBPC_1703
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBPC_1703
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBPC_1703
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LBPC_1703
Enzymes [BR:lpap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBPC_1703
Exosome [BR:lpap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBPC_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAN71999
UniProt: A0A0E1PNR4
Position
complement(1792501..1793682)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcgattaaggct
gcacgaattgacccagcgttactcaaccaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgtggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggcgatacaacgctggtt
gacggtttgagtcgcgatggattaaatgatgccttcagtcaacagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgtcagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system