KEGG   Lactobacillus parabuchneri: FAM21731_00192Help
Entry
FAM21731_00192    CDS       T04617                                 

Definition
(GenBank) ATP-dependent RecD-like DNA helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lpar  Lactobacillus parabuchneri
Pathway
lpar03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FAM21731_00192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpar03400]
    FAM21731_00192
Enzymes [BR:lpar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FAM21731_00192
DNA repair and recombination proteins [BR:lpar03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FAM21731_00192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 DUF2075 HHH_5 T2SSE AAA_22 RsgA_GTPase AAA AAA_28 NTPase_1 UvrD_C HHH cobW AAA_12 AAA_16 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: APR06440
UniProt: A0A1X1FHJ7
Position
complement(169892..172357)
Genome map
AA seq 821 aa AA seqDB search
MDQAMDLFGSQQNNNEPQYVDGRLKAIFFSSNDSFYKVVLVEITDTNINWPEDEIVVTGS
FGDLVEENSYHFMGKLVDHPRYGKQFQATNYSSLIATTQEGVIKYLSGDRFPGVGKKTAE
RVVDALGDDAIEKITADSRVLEDVPISPKSRSAIIDNLDSDDGLEKVIVGLNSYGFSSAI
ASSIYQKYHEDALTIIANNPYQLVEDIDGISFKRADAIALKLGLVPDSDERIRAGLMYAI
NELCLKNGDTYTTTQPLIEMASSVLEDNSEQQISGKKLAASLVALAKEGKVIGEENRIYL
TRLYNAEVQIADHLNRVIKNKDDEDQLKEDAIKKQLRVVEKKFDINYDDSQVAAIIQAIQ
SPVFILTGGPGTGKTTIINGIVNTYARLHEYSLDINAYKDKPFPIVLAAPTGRAAKHMTE
STGLPASTIHRLLGLNGRESNDVTGTKDIEGSLLIIDEMSMVDTYLFRSLVRAIPNHMQV
VLVGDQDQLPSVGPGQVFHDLLVSKQIPAMQLDTIYRQESGSSIIQLAHDIHSGHLSANF
TDNQSDRSFIPCNENQIGSVIEQVTNRARQKGFGLMDVQVLAPMYRGRAGIDRINDIVQN
VWQDQKSSKKSVTIRDHTYQIGDKVLQLVNNPERNVFNGDLGIIVGMEAPKGQKAPNKIT
IDFDETEVTYENNEWTQFTLAYCTSIHKAQGSEFKMVILPIVWQFSRMLQRNLLYTAVTR
ASDFLIMLGEKEAFEQCVKSVSVNRQTSLVKRLVDTIGVVGDKPSDSVDPDDDLVQADDP
SSTGSQATGLPDHLTTDVINQNVIDPMIGMADVSPKDFMKS
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
ttggatcaggcaatggatttatttggttcacaacaaaataataacgaaccacaatacgtt
gatggccgcttaaaggcgatcttcttttcgagtaacgacagtttttataaagtggttttg
gtcgaaattacggataccaatattaattggccggaagacgagatcgtcgtgactggcagt
ttcggggatttggttgaagaaaatagttatcattttatgggaaagttagttgaccatccc
cggtatggcaagcaatttcaagcgaccaattattcaagcttaattgcgaccactcaagag
ggcgtcatcaagtatctttcgggagatcgattcccaggggttggtaaaaaaaccgccgaa
cgggtcgtggatgccctgggtgatgacgcaattgaaaaaatcacggcggacagccgggtg
ttggaagacgttccgattagccctaagtcacgttcggccattatcgataatcttgattct
gacgatgggttggaaaaagtcattgtgggcctcaatagctatggcttttccagtgcgatt
gcgtcctcgatttatcaaaaataccatgaagacgcgttgacaatcatcgccaacaatcct
taccagttagttgaagatattgacggcattagttttaaacgggccgacgcgattgccctt
aaattgggcttggttcccgattccgacgaacggattcgggccggcttgatgtacgcgatt
aatgaactctgcttaaaaaatggcgatacttacaccacgactcagcccttgattgagatg
gcttcaagtgtgttggaagacaactccgaacaacagatttccggcaaaaagctcgctgcc
agtttggtggcccttgctaaagaaggtaaagtgattggcgaagaaaaccggatttactta
acccgcttgtataacgcggaagtccagattgccgatcatctcaatcgggtcattaaaaat
aaggacgatgaggatcagctcaaagaagacgcgattaaaaagcaacttcgagtcgttgag
aaaaaattcgatattaattatgacgactctcaagtcgctgcgatcattcaggccattcag
tcgccggtgtttatcctgacgggtggcccggggacagggaaaacaaccatcatcaatggg
attgtcaacacctatgcccgccttcatgagtattcattggatatcaacgcctataaagat
aagccgtttccaattgtcttggcggccccaactggccgggctgccaaacacatgaccgaa
tccaccggacttccggccagcaccattcaccggttgttgggactcaatggtcgggagtct
aacgatgtgaccggaaccaaagatattgagggcagcttgttgattattgacgaaatgtcg
atggttgacacttacctcttccgctcactggttcgagccatccccaaccacatgcaggtt
gtgttggtgggggatcaagatcagctgccatcagttggtcccggacaggttttccacgat
ttgcttgtctccaaacaaattccggcgatgcaacttgatacgatttatcgacaggaaagc
ggctcgtcgatcattcaattggcccatgatattcacagcgggcatttgtcggcgaacttt
acggataatcaatcggatcgatcctttattccctgcaacgaaaatcaaattggctccgtg
attgaacaggtcactaatcgggccaggcaaaagggctttggtttgatggatgtccaagtg
ttggcaccaatgtatcgcggccgggccggcattgatcgaattaatgacattgtccaaaat
gtctggcaggatcaaaagtcgtccaaaaagtcggtgacgattcgcgatcatacttaccag
attggcgataaagttttgcagctggttaataatcccgaacgcaatgttttcaacggggac
ctcggtatcatcgtcgggatggaagcgccaaagggccaaaaagccccgaacaaaattacc
attgattttgatgaaactgaggtcacttatgagaataatgagtggacccaatttaccttg
gcctactgtacgtcaattcataaggcacaaggtagtgagttcaagatggtgattttgccg
atcgtctggcagttttcacgaatgttgcagcgaaacctgctgtataccgcggtaacccgt
gccagtgatttcttaattatgctgggtgaaaaagaagcttttgaacagtgcgtcaaaagc
gtatcggttaaccgacaaaccagtctggtcaaacgactcgtcgatacgattggcgttgtt
ggggacaagccttctgacagtgttgatccagacgatgatttggtccaagcagatgatccg
tcttcaaccggctcacaagcgaccggccttccggatcatttgacgaccgatgtcatcaat
caaaacgtcatcgatccgatgattggcatggcggacgtctcgccgaaagactttatgaaa
tcctaa

DBGET integrated database retrieval system