KEGG   Lactobacillus parabuchneri: FAM21731_01401Help
Entry
FAM21731_01401    CDS       T04617                                 

Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lpar  Lactobacillus parabuchneri
Pathway
lpar00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FAM21731_01401
Enzymes [BR:lpar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FAM21731_01401
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FAM21731_01401
    1.1.1.-  
     FAM21731_01401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DUF2045
Motif
Other DBs
NCBI-ProteinID: APR07582
Position
complement(1469928..1470998)
Genome map
AA seq 356 aa AA seqDB search
MKAVRIYGEKDIRVEDVSIPEPKDDQVQIKVKYCGICGSDLHAYLEGWGLPTVPYPLTGK
TVPITLGHEFSGEIVKVGKDVDDLQVGDHVAVEPLLACGKCENCRAGNYNFCNKAVSTDG
AGNFLGFSEDGGMAEFANVQGVFAHKMPEDMDFELGALAEPTAVVYEAIKKSHLREGQNV
AVMGAGPIGLLEAVLAKIAGANHVYIVDVSKVRLDKAKELGIENALDPSKDDVEAIIKKD
LPNGVDITFECAGVQATFDSALKVTKRTGIIQVVALYAKPVTMNMTDDLIMQGKDVITTL
CYNNSFPNVLGIIDNHKDLFKKVVTKKVSLDDALEEGINALSTDKSQVKIMIDPSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcgcatttatggtgaaaaagatattcgggttgaagacgtttcaattcca
gaacctaaagatgatcaagttcaaattaaagttaaatattgtggaatttgtggaagtgac
cttcatgcctacctcgaaggctggggcctgccaaccgttccatatccactaaccggcaaa
accgttcccatcaccttaggccatgagttctcaggtgaaattgtcaaagttggaaaagat
gtcgatgacttacaagttggcgatcacgtggctgttgaaccattacttgcctgtggaaaa
tgtgaaaactgtcgggccggaaactacaacttctgtaacaaagcagtttcaactgatggt
gccggtaacttcttaggcttctcagaagacggtgggatggctgaatttgccaacgttcaa
ggcgtatttgcccacaagatgcctgaagacatggactttgaattaggtgctttggcagaa
ccaactgctgttgtttacgaagccattaagaagagccacttacgtgaaggtcaaaacgtt
gccgtgatgggtgccggcccaatcggcttattggaagctgtgttagctaaaattgctggc
gccaaccacgtttatatcgttgatgtttccaaggttcgtttggataaggccaaggaatta
ggtattgaaaacgctttggatccaagcaaagacgacgttgaagctattatcaagaaggac
ttgccaaacggcgttgacattaccttcgaatgtgcgggtgttcaagcaacctttgactcc
gcactcaaggtaaccaaacgaacaggaattattcaagttgttgcgctgtacgcaaagcca
gtaaccatgaacatgactgatgacttgattatgcagggtaaggacgttatcacgactctg
tgctacaacaattcattccctaacgttttaggaatcatcgacaaccacaaagacctgttt
aagaaagttgttaccaagaaagtcagcttagacgatgccctcgaagaaggaatcaatgca
ttatcaaccgacaaatcacaagttaagattatgattgatccatctctttaa

DBGET integrated database retrieval system