KEGG   Lactobacillus parabuchneri: FAM21731_01618Help
Entry
FAM21731_01618    CDS       T04617                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lpar  Lactobacillus parabuchneri
Pathway
lpar00561  Glycerolipid metabolism
lpar00640  Propanoate metabolism
lpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FAM21731_01618
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    FAM21731_01618
Enzymes [BR:lpar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     FAM21731_01618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase DUF1852 ABC_sub_bind
Motif
Other DBs
NCBI-ProteinID: APR07792
UniProt: A0A1X1FDU3
Position
complement(1696882..1697985)
Genome map
AA seq 367 aa AA seqDB search
MTKEFGSPSSYIQGNGVLFESDQYLKGFGDKPLLLTDDSVYNIVGQKFESYLKDHGYSVV
LVKFQGESSESEINRIAQIGKDENVSAIYGLGGGKTSDSAKAIADNLDIPVVIMPTLAST
DAPCSRLSVIYTDDGSFDHYRFYNHNPNLVLVDSHIIAGAPAHLLIAGIADALATNVEAQ
AVAQAGADTMLNEKQTLVGSAIGQKCEETLFKYAHIAVADVKQHVVTSALEKVIEANTLM
SGLGFESGGLSGAHAIHDGLTTLEQTHALTHGEKVAYGTLTQLMLEGADQDRYNKYFKLI
LSLGLPTTLADLHLENATDEELLAAGKAACSENDTIDRLPFKVEPNDVAQAFRAVDSYTK
EYLEANK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaatttggctcaccatcttcatatattcaaggtaacggtgttttatttgaa
agtgatcagtatctgaagggttttggcgacaagccactcttgctcaccgacgacagtgtt
tataatattgtcggccaaaaattcgaatcctacttaaaggatcacggctactcagttgtc
ctcgttaaattccaaggcgaatcatccgaaagtgaaatcaaccggattgcacaaattggt
aaagacgaaaatgtaagcgctatttatggccttggcggcggaaaaacaagtgattccgca
aaggccattgccgataacctcgatattcccgttgtcatcatgccaactttagcgtcaact
gacgcaccatgttcacgactttcagtgatttacacagatgatggcagctttgatcactat
cgtttctacaatcataaccccaacttggtattagttgacagtcacattattgccggtgcc
cctgcgcacttactgatcgccggaattgccgacgctttggcaaccaacgttgaagcccag
gcggttgctcaagctggtgccgataccatgttgaatgaaaagcagacattggttggaagt
gctattggccaaaaatgtgaggagacgttattcaaatacgcccatatcgcagtcgctgat
gttaagcagcacgtggtaaccagtgccctggaaaaagtcatcgaagcaaatactttgatg
agtggactgggctttgaaagtggtggactgtcaggtgcgcacgcaattcacgatggattg
acgacactggaacaaacccatgctttaacccatggtgaaaaagttgcttatggaaccttg
acccaattaatgcttgaaggtgccgatcaagaccgttacaacaagtatttcaagctgatt
ttatcattaggtctgccaacaaccttggctgatttacacttggaaaatgccaccgacgaa
gaactgctggctgcaggaaaagccgcttgttcagaaaacgacaccatcgaccgactccca
ttcaaggttgaaccaaacgacgttgcccaggcattccgagcagttgattcgtacaccaag
gaatacttggaagccaacaaataa

DBGET integrated database retrieval system