KEGG   Lactobacillus plantarum B21: SH83_00985Help
Entry
SH83_00985        CDS       T03680                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb00051  Fructose and mannose metabolism
lpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SH83_00985
Enzymes [BR:lpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SH83_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJO72995
UniProt: A0A0M5M5H4
Position
217539..218696
Genome map
AA seq 385 aa AA seqDB search
MLDVHFGAGNIGRGFIGETLADNGFKITFVDVNDTLIDELNKRNGYTIELAAEGQKHIEV
HDVKGINNGKDPKAVAEEIAQADMVTTAIGPKILKFIAPLIADGLKLRQANNNTTPIDII
ACENMIGGSQSLKKSVYESLNEDEQAWADQNAGFPNAAVDRIVPLQKHDDPLFVSVEPFK
EWVIDKSQMKNPKIQLKGVDYADDLEPYIERKLFSVNTGHATVAYTGNMKGYKTIGEAVK
DDSVVDQAKHVLGETGDLLIQKWGFDPEVHHAYQKKILSRFENPYISDDIERVGRTPIRK
LGFNERFIRPIRELKERGRDYSALVDTVGEMFFFNYPNDSESVKLQQLLKDEPIEQVIRE
TTDLKDEDLVNEIKAAYEKHLAAAK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgtacattttggcgcagggaatattggtcggggcttcattggcgaaaccttg
gctgacaacgggtttaagattactttcgttgatgttaatgatactttgattgacgaatta
aacaaacggaatggttataccattgaattggctgcagaaggtcaaaaacatattgaagtt
cacgatgttaagggtattaacaacggtaaggatcctaaggcggttgctgaagaaattgcc
caagccgatatggttacgactgcgattggacctaagatcttgaagttcatcgcgccatta
attgctgacgggttaaagttacggcaagctaacaacaatacgacaccaattgatatcatt
gcttgtgaaaacatgattggcgggagtcagtcattaaagaaatccgtttatgaatcatta
aatgaagacgaacaagcttgggctgaccaaaatgcgggcttccctaatgccgctgttgac
cggatcgtaccgcttcaaaagcatgatgatccattgttcgtttcagttgaaccattcaag
gaatgggttatcgacaagtcccagatgaaaaaccctaagattcaattaaagggtgttgat
tatgctgacgacttggaaccatacattgaacggaaactcttctccgttaatactggtcat
gccaccgtagcctatactggtaacatgaagggctacaagacgattggcgaagcggtcaag
gatgacagtgttgttgaccaagctaagcacgttttaggtgaaaccggcgacttgttgatt
caaaagtggggctttgatcctgaagtacaccatgcttatcaaaagaagattttgagtcgg
tttgaaaacccatatatctctgatgatattgaacgggtcggccggacaccaattcggaaa
ttaggtttcaacgaacgtttcattcgcccaattcgggaattgaaggaacgtggtcgcgat
tacagcgccttagttgatacagttggtgaaatgttcttcttcaactatcctaatgatagt
gaaagtgttaagttacaacaattattgaaggatgaaccaatcgaacaagtcattcgcgaa
acaactgacttgaaagatgaagatttagttaatgaaatcaaagctgcgtacgaaaagcac
ttagctgcagcaaagtag

DBGET integrated database retrieval system