KEGG   Lactobacillus plantarum B21: SH83_09635Help
Entry
SH83_09635        CDS       T03680                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb00430  Taurine and hypotaurine metabolism
lpb00620  Pyruvate metabolism
lpb00640  Propanoate metabolism
lpb00680  Methane metabolism
lpb01100  Metabolic pathways
lpb01120  Microbial metabolism in diverse environments
lpb01200  Carbon metabolism
Module
lpb_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SH83_09635
   00640 Propanoate metabolism
    SH83_09635
  09102 Energy metabolism
   00680 Methane metabolism
    SH83_09635
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SH83_09635
Enzymes [BR:lpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SH83_09635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AJO74570
UniProt: A0A0M4S883
Position
complement(2053453..2054646)
Genome map
AA seq 397 aa AA seqDB search
MGKTIAINAGSSTLKFKLFEMPQERVIAQGAVERIGFKTSPVNIRYGVDHHYQEKAVVAD
HLAAVNIVLDELIKLRIIDSYDEITGVGHRVVAGGEQFHDSVLITDQVLKQITDLAEYAP
LHNPANAVGIRAFKRVLPHVPAVAVFDTAFHASMPAVNYLYSLPYDYYQRYGARKFGAHG
TSHRYVAVRAAKLLGRPLETLKLITLHLGAGSSITAIDHGQSLDTSMGFTPLAGITMATR
SGDVDPSLVAYLMKKLNISDPDEMLTILNTQSGLLGLAGSADMQELEARYDEDSQAQLAI
DIFVNRIVKYVGAYLAELQGADALVITAGIGERDARMRQRIADRLTYFGVAIDPTKNQVS
GVERDLSTTDAKIRTLLIPTDEELMIARDVERVAQNQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttggggaagaccattgccatcaacgctggtagttcgacgttgaaatttaagttatttgaa
atgccacaggaacgggtgattgcacagggcgctgttgaacgaattggattcaaaacttca
ccggtcaatattcgctatggcgttgatcatcattaccaagagaaagccgtagtcgcggac
catttggctgccgtgaatatcgttttggatgagttaattaaattgcgaattattgactca
tatgatgaaattactggggtcggtcaccgggtcgttgctggtggcgagcaattccatgat
tcagttttaatcactgaccaagtgcttaagcagattacggatctggccgaatatgcgcca
ttgcataatccggctaatgcggtcggtattcgtgctttcaagcgggtactaccacatgtg
cccgcggtcgctgtctttgatacggcgtttcatgcaagtatgccggcggttaactatcta
tactcgttaccgtatgattactatcaacgatatggtgctcgcaagtttggcgctcatgga
acgagccatcgctacgtcgcggtgcgagcagctaaattattgggccgaccgctcgaaacg
ttgaagctgattacgttgcatttaggtgcgggaagttcgattacggcgattgatcatgga
cagtcactagatacctcgatgggatttacgccgttagctggtattacaatggcaacgcgc
tcgggtgatgtggatccgtcgctggttgcttatctcatgaaaaagcttaatattagcgat
cctgatgaaatgttaacgattttgaatacgcagtcaggcttactggggctagctggttct
gcagatatgcaggagctcgaggcacgttatgatgaggactcacaggctcagttagctatt
gatatttttgtcaatcggatcgttaagtatgtcggtgcttatttggctgagctacaaggt
gcggatgcattagtgataacggctggtatcggtgaacgggatgcacggatgcgacaacga
atcgcggatcggttgacctactttggcgtcgcgattgacccgactaagaatcaagtcagt
ggtgtcgaacgggacctgagtacgaccgatgcgaagattcggacgttactcattcctact
gatgaagaacttatgattgcccgcgatgttgagcgcgtggctcagaatcagtga

DBGET integrated database retrieval system