KEGG   Lactobacillus plantarum B21: SH83_11945Help
Entry
SH83_11945        CDS       T03680                                 

Definition
(GenBank) phosphohydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb00625  Chloroalkane and chloroalkene degradation
lpb01100  Metabolic pathways
lpb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SH83_11945
   00361 Chlorocyclohexane and chlorobenzene degradation
    SH83_11945
Enzymes [BR:lpb01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SH83_11945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AJO75002
UniProt: A0A162G8C4
Position
complement(2541823..2542485)
Genome map
AA seq 220 aa AA seqDB search
MTKKYLTFDCYGTLINTEPLYQWVANLGLAVGLDPLTVRKAYATYEDDPASVNPYLDYST
LVRADLKHLDRLFEQRHFFESHYVECLEVQRHLLPYADVIPTLTAWQQLGYQLIIMSNSS
WDIMPANIAALKVSFTAVVTAEDVQAYKPALAFFETVQERFKLTADNHWHIARGYESDVV
PASAMQWPMIWINRDQRQPTSSERPTHMVTDLAAAKQWVN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaatatttaacatttgattgttacgggacgttaattaatactgagccgctg
tatcaatgggtggctaatttaggattggcggttggtttagacccactaacggttcgcaaa
gcctacgcgacttatgaggacgatcctgccagtgtcaatccttatctagattattcaaca
ttagtccgggctgatcttaagcatttagatcgattgtttgaacagagacacttctttgaa
agtcattacgttgaatgcttggaagtgcaacgacacctattaccatacgccgatgttata
ccgaccttaacagcgtggcagcaattgggctatcaattgattattatgtcgaattcttcc
tgggatatcatgccggccaacattgctgctttaaaggtgtcgttcacagcggttgttacg
gctgaagacgttcaagcttacaaaccagcgttagctttctttgaaacggttcaagagcgt
tttaagttaacggcagataatcattggcatattgcacgtggctatgaatccgatgttgtt
ccagccagtgctatgcagtggccgatgatttggattaatcgtgatcagcgacaaccgact
agttctgaacggccgacccatatggttactgatttggccgctgctaagcagtgggttaac
tag

DBGET integrated database retrieval system