KEGG   Legionella pneumophila Corby: LPC_0854
Entry
LPC_0854          CDS       T00532                                 

Gene name
cpxR
Definition
(GenBank) transcriptional regulatory protein CpxR
  KO
K07662  two-component system, OmpR family, response regulator CpxR
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc01503  Cationic antimicrobial peptide (CAMP) resistance
lpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LPC_0854 (cpxR)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LPC_0854 (cpxR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lpc02022]
    LPC_0854 (cpxR)
Two-component system [BR:lpc02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   LPC_0854 (cpxR)
SSDB
Motif
Pfam: Response_reg Trans_reg_C DUF43
Other DBs
NCBI-ProteinID: ABQ54830
Position
complement(1652761..1653441)
AA seq 226 aa
MSSSILIIDDDTELTDLLTQYLEPEGFNVVCVHDGENGVKKALNQVFDAIILDVMLPKLN
GFEVLKAIREHLETPVLMLTARGDDIDRIVGLEIGADDYLPKPCNPRELVARLRAILRRT
QKIPTPKPIIEQHNIIVDCSKRHVTMGGKFLELTNAEFNILEMLIKSPGQAFSKEELTEY
ALGRKYTAYDRSIDVHISNLRNKLGDNPQGEPLVKTVRGFGYMFNA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagcagctctattctcattattgatgatgacacagaactaacagatttattaacccaa
tatttggagccagaaggctttaatgtagtatgtgtgcatgatggagaaaatggtgttaaa
aaagctttaaatcaggtatttgatgccattatactcgacgtcatgctgcccaagcttaat
ggttttgaagtattaaaagcaataagagagcatttggaaacacctgtattgatgttaact
gctcgtggtgatgatatcgatcgcattgttgggttagaaattggtgcagatgattactta
cctaaaccttgtaatccacgagagttagttgcacgtctgcgtgctattttaagacgcact
caaaaaatcccaactcccaaaccaattattgaacaacataatatcattgtggattgctcc
aaacgccacgtgactatgggaggaaaattccttgaattaaccaatgcggaatttaatatt
ttagagatgttaatcaaatcaccaggacaagcattttccaaagaggaactcaccgaatat
gctctgggaagaaaatacactgcttatgaccgcagtatcgatgttcacatcagcaattta
cgaaataaattaggcgataatcctcagggagaacctttagtcaaaactgtccgcgggttt
gggtacatgtttaatgcgtag

DBGET integrated database retrieval system