KEGG   Legionella pneumophila Corby: LPC_1269Help
Entry
LPC_1269          CDS       T00532                                 

Gene name
atoB
Definition
(GenBank) acyl CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00071  Fatty acid degradation
lpc00072  Synthesis and degradation of ketone bodies
lpc00280  Valine, leucine and isoleucine degradation
lpc00310  Lysine degradation
lpc00362  Benzoate degradation
lpc00380  Tryptophan metabolism
lpc00620  Pyruvate metabolism
lpc00630  Glyoxylate and dicarboxylate metabolism
lpc00640  Propanoate metabolism
lpc00650  Butanoate metabolism
lpc00900  Terpenoid backbone biosynthesis
lpc01100  Metabolic pathways
lpc01110  Biosynthesis of secondary metabolites
lpc01120  Microbial metabolism in diverse environments
lpc01130  Biosynthesis of antibiotics
lpc01200  Carbon metabolism
lpc01212  Fatty acid metabolism
lpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPC_1269 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LPC_1269 (atoB)
   00640 Propanoate metabolism
    LPC_1269 (atoB)
   00650 Butanoate metabolism
    LPC_1269 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPC_1269 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LPC_1269 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPC_1269 (atoB)
   00310 Lysine degradation
    LPC_1269 (atoB)
   00380 Tryptophan metabolism
    LPC_1269 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPC_1269 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPC_1269 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LPC_1269 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpc04147]
    LPC_1269 (atoB)
Enzymes [BR:lpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPC_1269 (atoB)
Exosome [BR:lpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPC_1269 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABQ55232
Position
2124410..2125594
Genome map
AA seq 394 aa AA seqDB search
MEHNDVVIVAAKRTPMGAMLGNLSALSSPELGAVAHMAALSQSGIAPAEIDEVISGCVLQ
AGIGQAPARQAAIKAGIPNSTGATTINKMCGSGMKAVMLAHDLIKAGTANVILASGMESM
SNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYDKGQLMGCFAETTAKHFNFSREQQDE
YALRSMTKALKAIENGAFREEIAPVTLTTRKGDITVDVDEGPETAKLAKIPQLKPAFQAD
GTVTAANSSSISDGAASLILMSASNAEKRGIKPLAKIIAHASHSQAPQWFTTAPVDAIRK
VMNKASWKQDDVDLFEINEAFAVVAMAAITQLELNPEQVNIHGGACALGHPIGASGARIL
VTLMHALKHQGKKRGIASLCIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatgatgtcgtgatagtcgcagcaaaaagaacaccaatgggagctatgcta
ggcaatttatctgcactttcctccccagagttaggggcagtagcgcatatggcagcgttg
tctcaatcaggtattgctccggcagaaatcgatgaagtgatcagtggttgtgtattacaa
gctggtattggtcaagctcctgccagacaggcagcaataaaagcaggcatacctaattcg
acaggagccacgaccattaataaaatgtgtggttcgggcatgaaggctgtgatgcttgcg
catgatttaattaaggcaggtacagctaatgtaattttggctagcggtatggaaagtatg
agcaatgccccctatttattatccaaagcacgagcaggatatagactgggtcatggtgaa
ctgaaagatcatatgttccttgatggattagaagatgcctatgataaaggacaattaatg
gggtgtttcgctgaaacaactgcaaaacactttaatttcagcagagaacaacaagacgaa
tatgccttacgctcaatgaccaaagcgctaaaagcaatagagaatggtgcctttcgagaa
gaaatcgctcctgtcaccttaactacccgcaaaggagatatcacggttgacgtcgatgaa
gggcctgagacagccaaacttgccaaaatacctcagttaaaaccagcctttcaagcagat
ggtacagtcacagcagccaattcaagttctatttcagatggcgcggccagtttaatttta
atgagtgcctcaaacgcagaaaaacgtggcattaagcccttggcaaaaatcatagcacat
gccagccattcccaagccccacaatggttcacaaccgctcctgttgatgcaatccgtaag
gtaatgaacaaagcgtcatggaaacaagatgatgtggatctttttgagattaatgaagcg
tttgcagtagtagcgatggcagcaattactcagcttgaattgaacccggaacaagtcaat
atacatggcggggcatgcgctttagggcatcccattggtgcttcgggagctcgcattctg
gttactttaatgcatgcgctaaaacaccagggtaaaaaacgcggaatagcttctttatgt
ataggcggtggtgaagcaacagctatggcaattgagctaatttaa

DBGET integrated database retrieval system