KEGG   Legionella pneumophila Corby: LPC_1870
Entry
LPC_1870          CDS       T00532                                 
Name
(GenBank) hypothetical protein
Organism
lpc  Legionella pneumophila Corby
SSDB
Motif
Pfam: DUF2895 HAD_SAK_2 TraE
Other DBs
NCBI-ProteinID: ABQ55802
Position
2814135..2814797
AA seq 220 aa
MFHYWKKVDSLNHINRLLLAFVFVLILIVFGLIITLAKIPNRFEFWLTPSMSSNGGLVKE
NAIPKEYVQGFVATLLPTLNTWSQGGKKEFATNLSGFHYYFTPRHQALMDKTLIAYKDAQ
LFNRIQVASLYRFMENEDVKVIAHNTWEVHLVLRITQRLKDDSPMVIADKIVDYHVRVVK
VNLSRLQNPFQLALDGYTQPETLITDLLATNTRGTQHDNN
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtttcattactggaaaaaagtggacagtttaaatcatatcaatcggttgttattagcc
tttgtattcgtactcattttgattgtatttggcctgatcattacgctggctaaaataccc
aatcgttttgaattttggctaacaccttctatgagtagtaatggtggattagtcaaggaa
aacgccatacccaaagagtacgttcagggttttgttgccacactgctacccaccttaaac
acctggtcacaaggtggtaaaaaagaatttgctactaatctttcaggctttcattactac
ttcactccacgacatcaggcattaatggataaaaccttgatagcttataaagatgctcaa
ctttttaatcgcatacaagtagcaagtctttatcggtttatggaaaacgaagatgtcaaa
gtaatcgctcataacacatgggaagttcatctggttttacgcattacccaacgcttaaaa
gacgatagccccatggtcattgcagacaagattgtggactaccatgtgcgtgtggtcaag
gtcaatctctctcgcttacaaaatccttttcaactggcattggatggttatacccaacca
gaaacactaatcaccgatttattggcaaccaatacaagaggtacacaacatgacaacaac
taa

DBGET integrated database retrieval system