KEGG   Legionella pneumophila Corby: LPC_1872
Entry
LPC_1872          CDS       T00532                                 

Definition
(GenBank) exported membrane protein
Organism
lpc  Legionella pneumophila Corby
SSDB
Motif
Pfam: CALCOCO1 Rootletin V_ATPase_I Muted DMSP_lyase UPF0242
Other DBs
NCBI-ProteinID: ABQ55804
Position
2815563..2816876
AA seq 437 aa
MKKNAGLKILTVTVIAVVALIMMNSKHHDREPEVTRPDPNNLNEAIASQFNDNIRDVAAR
LQETEKKLANLESENKQLRSKKENVQASYNPEVIKEIEQLKSELANVKTSQESQQNSQPY
TVNGESTLAKEQSVKDIDALLMNRESNPNEQAYWEGLKKTKQALTPKVKTAALNSKDKKS
IPYYTIPAGSDLGRTTLLSALIGEVPVEGKLMQPLFPFSAIINRGDLMAANGIPLPPNIS
GMKVNGYAIGVGSFLDNISCVRAYVTSALFVFDDGHFVTVGKEQMTGTAEMVNNESLGYL
TTAFGNPCIKGQYFTNAPRVLTALVASDGIKGFGNALSQWQMSYTANANGATGIPTGSMG
NYALGGALSQGTVKAADWLEKRIQGSFDMVFVPASQGYRPTQLSFHVTQTINLDKETNGR
VLDYGHLQQTAHDFSLR
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatgctggactcaaaatattaaccgtaacagtgatcgctgttgttgcactc
attatgatgaacagcaaacatcatgaccgtgaacccgaagtcactcgccccgatcccaat
aatctgaatgaagccattgccagccagtttaatgacaacatccgtgatgttgctgcaaga
ctacaggaaaccgaaaagaaacttgccaatcttgagtcggaaaacaagcaactcagaagc
aaaaaagaaaatgtgcaggcttcttataatcctgaggtgattaaagaaatagaacaacta
aaatccgaattggccaatgtcaaaaccagtcaggaatcccaacaaaactctcaaccctac
accgtcaatggagaatcgactcttgctaaagaacaaagtgttaaggacatcgatgcttta
ttaatgaatcgtgaaagtaatcctaatgaacaagcctattgggagggattaaagaaaaca
aagcaagcattaaccccaaaagttaaaacagcggctttaaacagtaaagataaaaaaagt
attccctattacaccattccagctggctctgatttaggcagaactaccttgttatcggca
ctgattggtgaggtgccagttgaaggcaaactcatgcagcctttatttcccttctcagcc
attattaatcgtggtgatttaatggctgctaatggtatccctttgcctcccaatatttca
ggtatgaaagttaatggttatgcaatcggtgttggttcttttttggataacatcagctgt
gttcgagcctatgtgacctctgctttgtttgtttttgatgacggccattttgtgactgtg
ggtaaagagcagatgactggaacagctgaaatggtcaataacgaaagtttaggttatctc
accaccgcttttggtaatccctgcattaaaggccagtattttactaatgctccaagagta
cttacagcacttgtggcttccgatgggattaaagggtttggtaatgcactttcccagtgg
caaatgagctataccgccaatgccaatggtgcgacaggcatacctaccggctccatgggc
aattatgctttaggtggtgcgctttcccagggaacagttaaagctgctgattggctggaa
aaacgtattcaaggcagcttcgatatggtttttgttccagcatctcaaggatacagaccg
acacaactttcatttcacgtcacacaaaccatcaaccttgataaagaaaccaatgggaga
gtattagattatggccatttacaacaaactgcacatgattttagccttaggtag

DBGET integrated database retrieval system