KEGG   Legionella pneumophila Corby: LPC_2280Help
Entry
LPC_2280          CDS       T00532                                 

Definition
(GenBank) hypothetical protein
Organism
lpc  Legionella pneumophila Corby
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859 TFIID_NTD2
Motif
Other DBs
NCBI-ProteinID: ABQ56203
Position
complement(1203504..1203935)
Genome map
AA seq 143 aa AA seqDB search
MIRILLLLLVALNVHSMNVIPLTLSQSDTSLKLNLSSPIGVPAKSKATAGKVSRKTLDTT
LLNMPLFVIGADKASIQWLEQHQEELKSMQATGFITNVNDFETIVALQEKFKLPLLPVNV
DPLLAYLHEQHYPLIIAEGAVWQ
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgattaggattctgctcttactgttggtcgcgttgaatgttcatagcatgaatgtcatt
cctttaacactgtcacaaagtgatacgtcattaaaattaaatctgtctagcccaataggc
gtcccagccaaaagcaaagccaccgcaggcaaagtcagccgcaaaacattggataccact
ttattaaacatgcctttgtttgtcataggtgcggataaagcatcgattcaatggttagag
cagcatcaagaagaattaaaatccatgcaagccacaggattcattaccaacgtcaatgac
tttgaaaccattgtcgctttgcaagaaaaattcaaattaccattactgcctgtcaatgtt
gatccattgcttgcataccttcacgaacaacattaccccttaatcattgctgagggggct
gtatggcagtaa

DBGET integrated database retrieval system