KEGG   Legionella pneumophila Corby: LPC_2286
Entry
LPC_2286          CDS       T00532                                 
Name
(GenBank) hypothetical protein
Organism
lpc  Legionella pneumophila Corby
SSDB
Motif
Pfam: DUF2895 Sec62 DUF5964 Phage_Treg TraE
Other DBs
NCBI-ProteinID: ABQ56209
Position
complement(1200894..1201550)
AA seq 218 aa
MFEYWKKIDSLQHHNRLLLAFISVLSVIVLALIINLMTMPKRYEFWLSPNMAANGGLMKA
SDIPNEYVQGFVSSLIPTLYTWSNKGKEEFNQNIKAFHYYFTPRHEQLLRDTLGAYKNAQ
LFDRSQVASLYRFMEPQDIRKISPDTWEVKLIMRITQRLKDNSGMVIADKVVAYHLRVVK
LNLSRLHNPFQLALDGYTRPEERLQDLLVDTEEPHETH
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtttgaatattggaaaaaaatcgacagcctacagcaccataaccgcttgttactggcc
tttatcagcgtgttatccgtcatcgttttggccttaatcattaacctcatgaccatgccc
aaacgctatgagttttggctaagccctaatatggcagccaatggcggtttaatgaaagca
agcgatatccctaatgaatacgtacaagggtttgtatcctcgttaatacccacgctatac
acttggtctaataagggcaaagaagaatttaaccagaatattaaagccttccattattat
tttactcctcgccatgaacaattactcagagacactttaggagcttacaaaaatgcgcag
ctttttgatcgcagccaagtagcaagcctctatcgcttcatggaacctcaagacattaga
aaaattagtcctgatacctgggaagtaaaattaatcatgcgcattactcaaagactgaaa
gacaacagcggtatggtgattgccgacaaggtagttgcctatcacctgcgtgtagtcaaa
ctcaacttgtctcgtttacacaaccccttccaactggctctcgatggctatacccgtcct
gaagaacggttacaagatttattggtcgacacggaggaaccccatgaaactcactaa

DBGET integrated database retrieval system