KEGG   Legionella pneumophila Corby: LPC_2292Help
Entry
LPC_2292          CDS       T00532                                 

Definition
(GenBank) membrane protein, Tfp pilus assembly, pilus retraction ATPase PilT
Organism
lpc  Legionella pneumophila Corby
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2096 DUF733
Motif
Other DBs
NCBI-ProteinID: ABQ56215
Position
complement(1193467..1194834)
Genome map
AA seq 455 aa AA seqDB search
MNKYLLLTLLIPHLTHAGNFMPSQSDYYYELGGTSNLFIPPVNKDQTLVIGADIDGRMGF
SCSGFNPVVSITNTFQDLKKSALNIPGGVIDNLKGSVAGFPLYKLQQSMPALYNVLQNAA
SSAQNEFTLKVKDCQEVKQALEQNQSPMEGILSVSDSQGWLDAAKRAKKENVDVTETSKS
IAQKRDEYGLPWIGSNKGNAGGKFQRPIKVINDVVIAGYNILLERKPLDSLEKPSTKIPM
VQSWPTPTDAANWAVKVLGDIQVSSSENKQSHDAKAGIGLSALLQSCANANTCSQNIAKA
LWNLVNGTWTLTEENLSKVSASNLLITDEVITTIQHLPREEQMLTVSKLAEEIAVQNMLD
KALMMRRILQAGLQVQEVQNLKPAMNMVLFALKKLDDDIHSLSFENDVRKKMMTETLGTI
MDIRHQAQSQNMPGQDHEQPAVKNGAIYVKENKGA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatctattattaaccttacttattccgcacctaacccatgccggaaacttt
atgcccagccaatcagattactattatgaattaggaggaacctccaatttatttatacca
cctgttaataaagatcaaacgctggttattggtgcagatattgatggccgtatgggattc
tcttgtagcggttttaatcctgtcgtatccattaccaatacctttcaggatttaaaaaaa
tcagcattaaatatccctggtggtgtcattgataacttaaaaggttcagtcgcaggattc
cctctttataagctgcaacagtccatgcctgctttatacaatgttctacaaaacgctgca
tccagtgcacaaaacgaatttaccctcaaggttaaagattgtcaggaagtcaaacaagca
ctggaacaaaaccaatctccaatggaaggcatattatcagtatccgatagtcaaggatgg
cttgatgctgccaaacgagctaaaaaggaaaacgtcgatgtgaccgaaacatcaaaaagc
atcgctcaaaagcgagatgaatatggtctaccctggataggcagcaataaaggcaatgcg
ggcggtaagtttcaacgcccaattaaggtaattaatgatgtagtcattgcgggctacaac
attcttttagagagaaaacctttagattctttggaaaaaccaagcaccaaaattcctatg
gtacaaagctggccaacacctaccgatgctgctaattgggcagttaaggttcttggcgat
atccaggtcagcagcagtgaaaacaaacaaagccatgatgctaaagcagggattggttta
tcagctttattgcaaagctgcgcgaacgccaatacctgtagccagaacattgccaaggcc
ttatggaatttagtcaatggtacttggacgcttactgaagaaaatctgagtaaagtcagt
gcctccaatttactgattactgatgaagtcattactactattcagcacctgccccgtgaa
gaacaaatgcttactgtctcaaaactggcagaagaaatcgctgttcaaaatatgctggat
aaagccttaatgatgcgccgcatcttacaagcaggattacaagtgcaagaagtacagaat
ttaaaacctgctatgaatatggtcttgtttgccctgaaaaaactagacgatgacattcat
tctttgtcctttgaaaacgatgtccgcaaaaaaatgatgactgagactttgggaaccatc
atggacattcgccatcaagcccaaagccaaaatatgccaggccaggatcacgaacagcct
gctgttaaaaacggcgcaatctacgttaaagaaaataaaggagcttaa

DBGET integrated database retrieval system