KEGG   Legionella pneumophila Corby: LPC_2296
Entry
LPC_2296          CDS       T00532                                 
Name
(GenBank) conjugative coupling factor TraD
Organism
lpc  Legionella pneumophila Corby
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C HerA_C DUF87 NACHT_N AAA_10 DUF308 BsuBI_PstI_RE_N
Other DBs
NCBI-ProteinID: ABQ56219
Position
complement(1189397..1191391)
AA seq 664 aa
MSNYPINNLLREPTEAWSAITCLSLALLAYTQPHLFLLTQTMGLYAALALLIPGIYRAWQ
AIKVKRYHRRLLAMPTYALSTTEIPLSKNWLFLGKGFRWRPSHTQKLHQIKQVKNEKFMQ
RSSCYQLARRFCQNHEHTKLAKWLNTNSKLNPFRPDPPVGGSPFLHGIGEEDKPVYIPQD
VRVGHTFVVGTTRVGKTRLASILINQDIRNGDAVIVVDPKGDQDLVRDMMAACKVSGRTE
DFKIVHLGFPEQSAQYNPLKNFDQISEVATRITDAISAEGEGKQFAAFAWKYVNIVAICL
EEMNQPLTYQTIAFYISRLEQLLMSYADKILPNHYPNYHQEIDEIIEEHDSKIGKNNKTK
SPMERHQAVIQYVKNHINKTIKNNNAEALHDQILIDLYDAAIMDKHYYDKITANVGPVLS
EINKSNASKILSSKAQPGEIELMDVIKNKKVLYIGLDSLTNPNIAQAVGKAFLSDLVSTA
GKIYKEPNARYTLNLHCDELSEIIQDSFVKILNKAGGAGFQVTAYAQTIQDMEVALGSRA
KAEVSEGNFNTLIMLRVKNEETANLLVKVLPQVGVVGHTQVSMVNDTPHGDDGVYFNTTN
EDRVQTSSVPMVGVDDIISLPKGQAFMIVNGGELYKTRIPLPISCKKQTKTPLPIFSTYI
NRTI
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgagcaattaccccattaataacctattaagagaaccaacagaagcctggtcagccatt
acctgtttgtctctagccttgctggcatatactcaaccgcatttgtttttactaacacaa
actatgggattatacgctgcgctcgcattgttaatccctggaatttatagagcctggcaa
gcaattaaagtaaaacgctatcaccgaagattattagccatgcccacttatgccctatcc
accacagaaatacctttatccaaaaactggttgttcttgggcaaaggctttcgctggcga
ccaagccacactcaaaagctgcatcaaattaaacaggtcaaaaatgaaaagttcatgcaa
cgaagctcttgctaccaacttgccagaagattctgccaaaatcatgaacatacaaagcta
gccaaatggttaaatacaaattctaaactaaacccttttagacctgatccacctgttggc
ggtagtccattcttgcatggtataggcgaagaagataaacctgtatacatccctcaagat
gtacgtgtcggtcataccttcgtagtcggtacaaccagagtaggaaaaacacggttggcc
agtattctaattaaccaagacatccgaaatggggatgcggttatcgttgtagatccaaaa
ggcgatcaagacctggttagagacatgatggcagcctgtaaagtatcaggccgaacagaa
gacttcaaaatcgtacacttaggctttccagaacaatctgcacaatacaaccccttaaaa
aatttcgaccaaatcagtgaggttgcaacacgtatcaccgatgcaatctccgcagaggga
gaaggaaaacagttcgcagccttcgcctggaaatacgtcaatatcgtggctatatgccta
gaagaaatgaatcaaccccttacctaccaaacaatagccttctatatcagccgactagaa
caattattaatgtcctatgctgataagattcttcctaaccactacccaaattaccatcaa
gagatagatgaaatcatcgaggagcatgatagtaaaataggcaaaaataataagacaaaa
tcccctatggaacgccaccaagcagtcattcaatatgtcaaaaaccacatcaataaaacg
atcaaaaacaacaatgctgaagctctgcacgatcaaatactaatcgacctctacgatgca
gccattatggataaacactattacgacaaaatcaccgccaatgtcggtcctgtactgtct
gaaatcaataaaagtaatgcctcaaaaatcctatcgtcaaaagctcaaccaggtgaaatt
gaattgatggatgtaattaaaaataagaaagttctttatatcggcttagatagcctaacc
aatcccaatattgcccaagcagtaggaaaagcctttttgtctgatctggtttccacagca
ggtaaaatctacaaagaacctaacgcgcggtacactttaaatctacactgcgatgagtta
tcagagattattcaggattcttttgtgaagattcttaataaggcaggtggtgctgggttt
caagtaaccgcttacgctcaaactattcaagatatggaagttgcactcggttccagagct
aaagcagaagtatccgagggaaattttaatactctaattatgctgcgtgttaaaaatgaa
gaaacagccaatttactggttaaggtgctgccacaagtaggtgttgtcggacatactcaa
gtttcgatggttaacgacacaccacatggggatgacggtgtttactttaatacgactaat
gaagatagagtccaaacgtcttctgtgccgatggttggagtggatgatattatttcttta
cctaaaggacaggcttttatgatagtaaatggtggagaactatacaaaactcgaattcct
ctaccaataagttgtaaaaaacagactaaaacaccattgccaatattcagcacctacatc
aatcgcactatatga

DBGET integrated database retrieval system