KEGG   Legionella pneumophila Corby: LPC_2769Help
Entry
LPC_2769          CDS       T00532                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00020  Citrate cycle (TCA cycle)
lpc00310  Lysine degradation
lpc01100  Metabolic pathways
lpc01110  Biosynthesis of secondary metabolites
lpc01120  Microbial metabolism in diverse environments
lpc01130  Biosynthesis of antibiotics
lpc01200  Carbon metabolism
Module
lpc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LPC_2769 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    LPC_2769 (sucB)
Enzymes [BR:lpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LPC_2769 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABQ56672
Position
665884..667113
Genome map
AA seq 409 aa AA seqDB search
MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL
FNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKSTSPVVR
RMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAEVQKESSMRALSFGGREE
KRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSFEKKHGVKLGFMS
FFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVVPVIRDADQLSMAEIE
LAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPPQTGILGMHKIEERPI
VEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRLLLNV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagtcaaagtacctgttctacccgagtcagtagctgatgcaacagtggct
gcgtggcataagaaagtgggtgataaagtatctcgcgatgagaacctagttgatctggaa
acagataaagttgtgcttgaagttccatcacctgtggatggggtattgtctgacattctg
tttaataccggagatacggttggttcaggagacttactggcaaaaatttctcaaagtgtt
tccgtagaatctcaaaaaactgagaaagaagagaaacctgtcaaaaaagaagaaataaaa
atttccgaaagtgaatcagttagcacaaaagaagataaatcaaccagtccggtggtaaga
cggatgatggctgaaaatgatttgaaagccgggcagattcaaggtaccggtaaagatggc
aggataaccaaagaagatgttttatcttacatagaatccaatagagaaaaatcaaaccaa
actgctgaagttcaaaaagaatcttctatgagagcactttcttttggtggcagggaagaa
aaacgtgtccctatgacgagactaagagccaagattgcagaacgtttattacaagcacag
cacaatgctgccatgttaaccacttttaacgaagtgaatttaaaggcagttatggatatg
cgttctcagtataaagatagctttgaaaaaaaacatggtgtaaaacttggatttatgtct
ttttttacgaaagcggtagtggagtcgcttaaacgatttccggctgtaaatgcttcaatt
gatggccaagatattgtttatcatggcttctatgatataggaattgctgtttctactgaa
agaggtttagtcgttccggtgattagagacgctgatcagttaagtatggcagaaattgaa
ttagccattaatgacgctgcatcaaaagccagaaccggaaaattatctatggaagagatg
caaggggggacatttaccataactaacggtggagtcttcggttcacttttagctactccc
attatcaacccaccgcaaactggtattttagggatgcataaaattgaggaaagacctatt
gtagagaaagggcaaatagtaatccgtcctatgatgtatgttgctttatcctatgatcat
cgtttaattgatggaaaagattctgtacaatttttagtgagtgttaaagagctgttggaa
gatccatcccgacttttactgaatgtttaa

DBGET integrated database retrieval system