KEGG   Lactobacillus paracollinoides: AYR62_02210Help
Entry
AYR62_02210       CDS       T04675                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lpd  Lactobacillus paracollinoides
Pathway
lpd00900  Terpenoid backbone biosynthesis
lpd01110  Biosynthesis of secondary metabolites
lpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYR62_02210
Enzymes [BR:lpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     AYR62_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ANZ63030
UniProt: A0A1B2IUT5
Position
525631..526917
Genome map
AA seq 428 aa AA seqDB search
MASSFSHFYKRDAQERLQIIADHSGLSDAQSAQLVSRAAQGDAKALIENYLTAFQLPEGV
AVNFQINDHDYVVPMVTEEPSVIAAASNGAKTIADAGGIQAEVKSRLLMGQIVLSDVKVF
ASIDDWVALHTDELLEVARKAHPTIVSRGGGPRSIRTRDLGEGYVSIDLYADVKAAMGAN
MLNTMLEAMAEVIQTKLHHTTLFSILSNTADQSLATATCSIPVTALKNATQSGADVAVRI
ASASRVAQLDPYRAVTHNKGIMNGVDAVVIAMGNDWRAIEAAAHAFAVVDGQYRGLSTWT
VQNDQLLGQLTLPLPVGTVGGATKVLPVVKINQQIATVKTPEDLMMIIVSVGLAQNFAAL
KALVTDGIQKGHMKMQLRSLALSAGATVNELKPMVAYLKTLSDPTAAAAETKLKELRTQI
KDDNDAKH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctcattttcacatttctataaacgtgacgcacaggaacggcttcagatcatt
gctgaccattccggcttaagcgacgcccaaagcgcgcagttagtttcacgtgcagcgcag
ggtgacgcgaaggcattgattgaaaactacctaacagcttttcagctgcctgaaggggtg
gcggttaactttcaaattaacgatcacgattacgtggtgccaatggtgacagaagaaccg
tctgtcattgccgctgccagcaatggcgctaaaaccattgcggacgctggcgggattcag
gctgaagtgaagtcgcggttactcatggggcagatcgtcctcagtgatgtgaaggtgttt
gcttccattgatgactgggtggcgctgcacacggatgaactgcttgaggtggcgcgaaaa
gcccacccaaccatcgtgtcccggggtggcggtccacgctcgatccggacgcgtgacctt
ggcgaaggctatgtgtccattgacctttacgcagatgtaaaggccgcgatgggggcgaac
atgctaaacacaatgctggaagcgatggctgaggtcattcaaaccaagttgcatcacacc
acgttatttagcatcttatccaatacggccgatcagagtttggcgacagccacctgcagt
attccggtgacggcacttaaaaatgcaacgcagtccggtgctgatgtggcggtgcgcatc
gcttcggcgagtcgtgttgcccagttggatccctaccgcgcggtgacacacaataagggc
atcatgaacggtgttgatgcggtggtgattgccatgggcaatgactggcgtgctattgaa
gcagccgcccacgcgtttgcggtggttgatggccaatatcgcggcctcagtacctggacc
gtgcagaatgatcagctgttggggcaattaacgttaccgttacccgttggcacagttggc
ggggctactaaggtgttgcctgtggtgaaaatcaaccagcaaattgccaccgttaagacc
ccggaagacttaatgatgattatcgtttcagtcgggttggcgcaaaattttgctgcgctc
aaagcgctcgtgacagatggcattcaaaaaggccatatgaaaatgcaactgcggtcccta
gccttgagcgccggtgcaacggtcaatgagctaaaaccgatggtggcttatctcaagacc
ctgagcgacccaacagcggcagctgccgagacaaaattaaaagaacttagaactcaaata
aaggatgacaacgatgcaaaacattga

DBGET integrated database retrieval system