KEGG   Lactobacillus paracollinoides: AYR62_04330Help
Entry
AYR62_04330       CDS       T04675                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lpd  Lactobacillus paracollinoides
Pathway
lpd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AYR62_04330
Enzymes [BR:lpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AYR62_04330
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AYR62_04330
    1.1.1.-  
     AYR62_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 UDPG_MGDP_dh_N ApbA DZR Pyr_redox_3 2-Hacid_dh_C 3HCDH_N Met_10 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ANZ63382
Position
993366..994436
Genome map
AA seq 356 aa AA seqDB search
MKAVRIYGEKDVRVEDVTIDDPKDDEVQVRVKYCGICGSDLHAYLEGWGLPTQPYPLTGK
TVPITLGHEFSGEVVKVGKDVDTLKIGDDVAIEPLIACGKCENCRKGDYNFCNNAVAADG
AGNFLGFSQDGGFAEFANVQGVFAHKLPEGMDPELGAVAEPTAVVYEAVKRSGLREGENV
AVMGAGPIGLLMALLAKISGANKVYIVDVSKVRLAKAKELGIENTINPSEEDVNEVIRKD
LLNGVDITFECAGVQATFDTALKVTKRTGTLQVVALFGKDVSMNMTDDVIMQGINITTTL
CYNNSFPAVLGIINNHPDTFRKIITKEIGLDQDVDEGIKALAEDKSQVKILVSPDL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtacgaatttatggggaaaaagatgttcgggttgaagatgttacgatcgat
gatccaaaggacgatgaagtccaagtccgtgtgaagtattgcgggatttgcggcagtgat
ctccatgcctatttggaaggctgggggttaccaactcaaccatatccgctgactggcaaa
acggttcctattacactaggtcatgaattttcaggcgaggtcgttaaggtcggaaaggac
gttgacaccctcaagattggtgacgatgttgcaatcgaaccattaattgcgtgtggtaag
tgcgaaaactgccggaagggtgactataacttctgtaacaatgccgttgcagcagacggt
gccgggaacttcttaggcttctcacaagatggcggctttgcggaattcgcaaacgttcag
ggcgtttttgctcacaaactgccagaaggcatggatcctgaattaggtgccgttgctgaa
ccaactgctgtggtttatgaagccgttaaacgcagtggcttgcgtgaaggtgaaaatgtg
gcagttatgggtgccggcccaatcggtctcttaatggcactacttgctaaaattagtggt
gccaacaaggtctacattgtggacgtttcaaaagtccgcctcgcaaaggctaaggaactt
ggtatcgaaaacacgattaatccatccgaagaagacgttaacgaagtcattcgtaaagac
ctgctaaacggggtcgacattacgtttgaatgtgcgggtgttcaggcaacctttgataca
gccctgaaagtgacaaaacggactgggacattgcaagttgttgcactgtttggtaaagac
gtttcaatgaacatgacggatgacgtgatcatgcaaggcatcaatatcacgacaacgttg
tgctacaacaactcattcccagccgtgttgggcattatcaacaaccatcctgacacattc
cggaaaatcatcactaaggaaattggccttgatcaagacgttgacgagggaatcaaagca
ttagctgaagataaatcacaggttaagattttggtgtcaccggacctgtag

DBGET integrated database retrieval system