KEGG   Lactobacillus paracollinoides: AYR62_11605Help
Entry
AYR62_11605       CDS       T04675                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lpd  Lactobacillus paracollinoides
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lpd03009]
    AYR62_11605
Enzymes [BR:lpd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AYR62_11605
Ribosome biogenesis [BR:lpd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AYR62_11605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_4 MTS Methyltransf_33 N6_N4_Mtase
Motif
Other DBs
NCBI-ProteinID: ANZ64656
Position
complement(2577791..2578636)
Genome map
AA seq 281 aa AA seqDB search
MNKIALASQFLTAHLNQFECPVCHAPFTAIDDGTLRCQNDHTFDLSKKGTLFFLNAPVNT
EYTDEMLRNRQQMLTSGFFEPMLGEVVKHLQGDLVLDAGSGEGTTTKWLASHYPSGDFVG
LDISKPAINIAGSGVVSDPQPLFAVGDLAKLPFETNALSSIVNILSPANYQEFDRVLQPG
GVLIKVIPNSHYLTELRQLVYPEGEHATYDNAPVKQHFIAQYGEVDFVPVQYQFELTPAL
FKALFAMTPLTWQASEERRNEILNQGLPNITADFEVGIVHL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaaatcgcccttgcaagccagtttctcacagcacacctgaaccagtttgagtgt
cctgtgtgccacgccccatttacagcaatagatgacggcacgttgcgttgccaaaacgac
cacacttttgatctatccaagaaggggacacttttctttctgaacgcccccgttaacacg
gaatatacggatgagatgctgcgcaaccggcaacagatgcttaccagcggtttctttgaa
ccgatgctgggtgaggtcgtcaagcatctgcagggtgatcttgttttggatgccggtagt
ggggaagggacaacaactaaatggcttgcttcccactatccatcaggtgattttgttggg
ttggacatctcaaagccggcaatcaatatcgctggttccggcgtggtcagtgatccgcag
ccgttgtttgcggttggtgaccttgctaagttgccgtttgaaaccaatgcgctgagcagt
atcgtcaacattctgtcgccagcaaattatcaggagtttgaccgggtgctgcagccgggt
ggtgtgctgatcaaggttatcccaaacagccattatttgaccgaattacgccaacttgtt
tatcctgaaggggaacatgccacttacgacaatgcaccagtcaagcagcattttattgct
caatatggtgaggttgacttcgtgccagtccagtaccagtttgagttgacgccagccttg
tttaaagcactttttgcaatgacaccgctgacctggcaggctagtgaagaacgacgaaat
gagatcttaaaccagggattacctaacataacagctgactttgaagttggtatcgtgcat
ctgtaa

DBGET integrated database retrieval system