KEGG   Lactobacillus paracollinoides: AYR62_14420Help
Entry
AYR62_14420       CDS       T04675                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpd  Lactobacillus paracollinoides
Pathway
lpd00071  Fatty acid degradation
lpd00072  Synthesis and degradation of ketone bodies
lpd00280  Valine, leucine and isoleucine degradation
lpd00310  Lysine degradation
lpd00362  Benzoate degradation
lpd00380  Tryptophan metabolism
lpd00620  Pyruvate metabolism
lpd00630  Glyoxylate and dicarboxylate metabolism
lpd00640  Propanoate metabolism
lpd00650  Butanoate metabolism
lpd00900  Terpenoid backbone biosynthesis
lpd01100  Metabolic pathways
lpd01110  Biosynthesis of secondary metabolites
lpd01120  Microbial metabolism in diverse environments
lpd01130  Biosynthesis of antibiotics
lpd01200  Carbon metabolism
lpd01212  Fatty acid metabolism
lpd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYR62_14420
   00630 Glyoxylate and dicarboxylate metabolism
    AYR62_14420
   00640 Propanoate metabolism
    AYR62_14420
   00650 Butanoate metabolism
    AYR62_14420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYR62_14420
   00072 Synthesis and degradation of ketone bodies
    AYR62_14420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYR62_14420
   00310 Lysine degradation
    AYR62_14420
   00380 Tryptophan metabolism
    AYR62_14420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYR62_14420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYR62_14420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYR62_14420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpd04147]
    AYR62_14420
Enzymes [BR:lpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYR62_14420
Exosome [BR:lpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYR62_14420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANZ65158
Position
complement(3217674..3218852)
Genome map
AA seq 392 aa AA seqDB search
MNEVVILSAVRTPIGKMGRSLSSLSSVDLGTLAAKKAIEQAHIAPEIISQAIVGNVLQAG
VGQNVARQIALKSGLSETSTAMTINQVCGSGLKAIRLGQSAIMLGDAEAVLVGGTESMTN
VPHLVPNMRQGKPYGSTTMLDGLEHDGLLDAFSHKPMGITAENVAHKYHVTREAQDALAL
RSHQRAVKATESGAFNDEIVPVTITLKKGTTTITRDEPIRPDTSMAALAGLKPAFVPNGM
VTAGNAAGLNDGASMLVLMSKARAEQANIPYLAVLDTYQEAGIDPNYMGYAPFYAVNQLL
AKQQMSIDDIDRFEINEAFAAQTVAVMRDLQIPDDKVNVNGGAIALGHPVGASGARIVTT
LVHDLKRENLKTGIATLCVGGGMGVALSLHLE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggtcatcttaagcgctgttcgaacgcccatcggtaaaatggggcgcagc
ttatcaagtttgtcatcagttgacctggggacgctggcggctaaaaaagcaatcgaacag
gcacacattgcccctgaaataatcagccaagccattgtcggtaatgtcctgcaggcgggt
gtgggacaaaacgtcgctcgtcaaatcgcacttaaaagcgggttatcagaaaccagcacc
gcaatgaccatcaatcaagtgtgcgggtctggactaaaggccatccggttgggtcaaagc
gccattatgttaggcgacgctgaagccgttttggttggcggcacggagagcatgacaaac
gtgcctcaccttgtcccaaatatgcgacagggcaagccatacggtagtacaacaatgctc
gacgggttggagcatgacggccttctggacgctttttcacacaaaccaatggggatcacg
gccgagaacgttgctcacaaatatcatgtcacacgcgaagcacaggatgctttggcacta
agatcacatcagcgagccgttaaagccaccgaatccggcgcgttcaatgatgagatcgtg
ccagtgacgatcaccttaaagaagggcacgaccaccatcacccgtgacgaaccaatccgt
ccagatacgtccatggccgccctggccggattaaaaccggcattcgtcccgaacggtatg
gtgactgccggcaacgctgcgggcttaaacgatggtgccagcatgctggtcctcatgtcc
aaagcgcgagctgagcaagccaatatcccttacttagccgttctggatacgtaccaagaa
gccggcatcgaccctaactatatgggctatgcacccttctatgctgtcaatcaactccta
gcaaaacaacaaatgagtattgatgacatcgaccgcttcgaaatcaacgaggcattcgca
gcccaaacggtcgccgtcatgcgcgatctgcaaattccagacgataaggtcaacgtcaat
ggtggcgcaatcgcattgggccacccggtgggcgcgtcgggtgccagaatcgtcaccact
ctggtccacgatttaaaacgagaaaacctaaaaacaggtattgccaccctctgcgtaggc
ggcgggatgggcgtggcgctgagtctacaccttgagtaa

DBGET integrated database retrieval system