KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_0534Help
Entry
lp12_0534         CDS       T01726                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00020  Citrate cycle (TCA cycle)
lpe00190  Oxidative phosphorylation
lpe00650  Butanoate metabolism
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01130  Biosynthesis of antibiotics
lpe01200  Carbon metabolism
Module
lpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lpe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lp12_0534
   00650 Butanoate metabolism
    lp12_0534
  Energy metabolism
   00190 Oxidative phosphorylation
    lp12_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEW50811
UniProt: G8UST8
Position
573679..574026
Genome map
AA seq 115 aa AA seqDB search
MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLSFSQWHLLFTNKAFQIA
TTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLTQFIWGLMIIWGQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtcaccagtttaacaggaaatgggttaaaggattggttaattcaacga
gttaccgctgtctattttgcagcctatttaatttttttgtttggatttatattggcaaat
cctgatttaagtttttctcaatggcatcttttgtttactaacaaggcatttcaaattgca
acaacaattggattgatggctttgacattgcatgcctggataggtatttggacagtaact
acagattatatgaaatgtactgttatacgtttatcagtgcagttattagttgttttgtgg
ctccttactcaatttatctggggccttatgatcatttggggacaatag

DBGET integrated database retrieval system