KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_1581Help
Entry
lp12_1581         CDS       T01726                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00260  Glycine, serine and threonine metabolism
lpe00750  Vitamin B6 metabolism
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp12_1581
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lp12_1581
Enzymes [BR:lpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lp12_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Ntox44
Motif
Other DBs
NCBI-ProteinID: AEW51844
UniProt: G8UV29
Position
complement(1733343..1734671)
Genome map
AA seq 442 aa AA seqDB search
MSLKVTYWLIIFHQKVQRLQMKIRIKSTRGQCVSTIDEAILSGLAGDGGLFVPDRFPNLT
IKKFYEYGNLIDFSVNLLSPFFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGP
TLSFKDLGTQFFSECLLHLIENKSAKVLVATSGDTGAAIAHALDGKRDLEGIILFPKDKL
TFRQQSQITCWGENIRALAVNGSFDQCQQLVKLVFAKREHKGILTTANSMNIARLLPQII
FYAFTSIQLALRHNHSVNFIVPGGNLGNVTACYWAKMLGFPVEQILIANNINSALGEFLL
TGAYQAKSVTKTLATAMDVGEPSNLDRLFVLFNNYSECKKQMNAESVSDEQIKQAILHCY
NKYHYIICPHTATAYHRLSTINQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKVLL
GRKQHYSIIEPNYHALYHFLVE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttgaaagtgacttactggttaataatatttcatcagaaggtgcaaaggctgcag
atgaaaattagaataaagagtacgagaggacaatgtgtctccacaatagacgaagcgata
ctgtcaggcctggcaggggatggtgggttatttgtacctgacaggtttcccaatttaaca
ataaaaaaattttatgaatacggtaatttaatcgacttttctgttaatttactctcgcca
tttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctcaccttc
tcctttccgttacatcatctttttaagaaaagttatgtactggagttgtttcatggccca
accctgtcttttaaagatttaggaactcaatttttcagtgaatgtttattgcatctgata
gaaaacaagagcgccaaagttctggtcgcaacatctggtgatactggcgctgcgattgct
catgctttggatgggaaaagagatctggaaggaatcattttatttcctaaagataaactt
actttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattggctgtt
aatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaagagaacat
aaaggaatattgactacagccaatagcatgaatatagccagattattaccacagattatt
ttctatgcttttaccagcattcaattggcattaagacataatcattctgttaattttata
gttccaggcggaaacctggggaatgttacggcttgttattgggcaaaaatgctgggtttt
ccggttgagcaaattttaatagctaataatattaatagtgcactgggcgaatttttgtta
actggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggatgtaggt
gagccaagcaatttggaccgcttattcgttttatttaataattattctgaatgtaaaaaa
cagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacattgttac
aataaatatcattatataatttgccctcataccgccacagcttatcatcgtctaagtaca
atcaatcaggacaaaccctgggttattgtggcaccagggcacccggccaaatttgaagag
gtattagaaccactattgaaaaaagaaattcctgtcccggaacagctgaaggtcctttta
ggcagaaaacaacattattcaatcatagagccaaactatcatgctttgtatcatttctta
gttgaatga

DBGET integrated database retrieval system