KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_1764Help
Entry
lp12_1764         CDS       T01726                                 

Definition
(GenBank) acyl CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00071  Fatty acid degradation
lpe00072  Synthesis and degradation of ketone bodies
lpe00280  Valine, leucine and isoleucine degradation
lpe00310  Lysine degradation
lpe00362  Benzoate degradation
lpe00380  Tryptophan metabolism
lpe00620  Pyruvate metabolism
lpe00630  Glyoxylate and dicarboxylate metabolism
lpe00640  Propanoate metabolism
lpe00650  Butanoate metabolism
lpe00900  Terpenoid backbone biosynthesis
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01130  Biosynthesis of antibiotics
lpe01200  Carbon metabolism
lpe01212  Fatty acid metabolism
lpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lp12_1764
   00630 Glyoxylate and dicarboxylate metabolism
    lp12_1764
   00640 Propanoate metabolism
    lp12_1764
   00650 Butanoate metabolism
    lp12_1764
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lp12_1764
   00072 Synthesis and degradation of ketone bodies
    lp12_1764
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lp12_1764
   00310 Lysine degradation
    lp12_1764
   00380 Tryptophan metabolism
    lp12_1764
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lp12_1764
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lp12_1764
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lp12_1764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpe04147]
    lp12_1764
Enzymes [BR:lpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lp12_1764
Exosome [BR:lpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lp12_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEW52026
Position
1960142..1961326
Genome map
AA seq 394 aa AA seqDB search
MEHNDVVIVAAKRTPMGAMLGNLSALSSPELGAVAHMAALSQSGIAPAEIDEVISGCVLQ
AGIGQAPARQAAIKAGIPNSTGATTINKMCGSGMKAVMLAHDLIKAGTANVILASGMESM
SNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYDKGQLMGCFAETTAKHFNFSREQQDE
YALRSMTKALKAIENGAFREEIAPVTLTTRKGDITVDVDEGPETAKLAKIPQLKPAFQAD
GTVTAANSSSISDGAASLILMSASNAEKRGIKPLAKIIAHASHSQAPQWFTTAPVDAIRK
VMNKASWKQDDVDLFEINEAFAVVAMAAITQLELNPEQVNIHGGACALGHPIGASGARIL
VTLMHALKHQGKKRGIASLCIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatgatgtcgtgatagtcgcagcaaaaagaacaccaatgggagctatgcta
ggcaatttatctgcactttcctccccagagttaggggcagtagcgcatatggcagcgttg
tctcaatcaggtattgctccggcagaaatcgatgaagtgatcagtggttgtgtattacaa
gctggtattggtcaagctcctgccagacaggcagcaataaaagcaggcatacctaattcg
acaggagccacgaccattaataaaatgtgtggttcgggcatgaaggctgtgatgcttgcg
catgatttaattaaggcaggtacagctaatgtaattttggctagcggtatggaaagtatg
agcaatgccccctatttattatccaaagcacgagcaggatatagactgggtcatggtgaa
ctgaaagatcatatgttccttgatggattagaagatgcctatgataaaggacaattaatg
gggtgtttcgctgaaacaactgcaaaacactttaatttcagcagagaacaacaagacgaa
tatgccttacgctcaatgaccaaagcgctaaaagcaatagagaatggtgcctttcgagaa
gaaatcgctcctgtcaccttaactacccgcaaaggagatatcacggttgacgtcgatgaa
gggcctgagacagccaaacttgccaaaatacctcagttaaaaccagcctttcaagcagat
ggtacagtcacagcagccaattcaagttctatttcagatggcgcggccagtttaatttta
atgagtgcctcaaacgcagaaaaacgtggcattaagcccttggcaaaaatcatagcacac
gccagccattcccaagccccacaatggttcacaaccgctcctgttgatgcaatccgtaag
gtaatgaacaaagcgtcatggaaacaagatgatgtggatctttttgagattaatgaagcg
tttgcagtagtagcgatggcagcaattactcagcttgaattgaatccggaacaagtcaat
atacatggcggggcatgcgctttagggcatcccattggtgcttcaggagctcgcattctg
gttactttaatgcatgcgctaaaacaccagggtaaaaaacgcggaatagcttctttatgt
ataggcggtggtgaagcaacagctatggcaattgagctaatttaa

DBGET integrated database retrieval system