KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_2478Help
Entry
lp12_2478         CDS       T01726                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00010  Glycolysis / Gluconeogenesis
lpe00030  Pentose phosphate pathway
lpe00051  Fructose and mannose metabolism
lpe00052  Galactose metabolism
lpe00230  Purine metabolism
lpe00500  Starch and sucrose metabolism
lpe00520  Amino sugar and nucleotide sugar metabolism
lpe00521  Streptomycin biosynthesis
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp12_2478
   00030 Pentose phosphate pathway
    lp12_2478
   00051 Fructose and mannose metabolism
    lp12_2478
   00052 Galactose metabolism
    lp12_2478
   00500 Starch and sucrose metabolism
    lp12_2478
   00520 Amino sugar and nucleotide sugar metabolism
    lp12_2478
  Nucleotide metabolism
   00230 Purine metabolism
    lp12_2478
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lp12_2478
Enzymes [BR:lpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     lp12_2478
    5.4.2.8  phosphomannomutase
     lp12_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEW52722
UniProt: G8UX60
Position
complement(2760742..2762130)
Genome map
AA seq 462 aa AA seqDB search
MTYQQKQIPRSVFRAYDIRGIIGKELDENSFYNIGLAIARYLQKLNRRQIFVARDGRLTS
HALATALKEGLLDSGIDILDLGAVATPVMYYATHTQGIDSGLMVTGSHNPADYNGIKLVL
AGKTLIQDEIDTLYALLGEVKQSAVRGTETAFDVIEGYIQRIVSDIQLKRPLKVVVDCGN
GVAGPIIPRAISKLGCEVIPLYCEVDGRFPNHHPDPSIEANLVDLKAAVANHQADIGLGF
DGDADRLGLVTNKGEVIWPDRLMMFYSREILSRNPGATVVFDVKCSSHLEKEIQAAGGVA
RMCPTGHSIVKAVMKKEQAILAGEMSGHLFFKDRWYGFDDALYSACRLLEIISFSHLTVS
EQFELIPNSVNTPEIKIAITDEEKFDFIQRFSEQADFPEGRILNIDGLRVEFPNGWGLLR
ASNTTPCLVARFEATDKDHLEQIQYLFKKQIQRLDSELDLPF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcaacaaaaacaaattccccgctctgtctttcgtgcctatgacattaggggg
attatcggtaaagaactggatgagaattctttttataacattggtttagctattgcacgt
tatttacaaaaattaaatcgtcgacaaatatttgtagctcgtgatggacgtctgaccagt
catgcattggctacggccttgaaagagggtttgctagacagtgggatagatatccttgat
cttggtgctgtggcgacacctgtcatgtattatgctacccatacgcaagggattgattct
ggattgatggttaccggaagtcataatcctgctgattataatggtatcaagttagtattg
gctggaaaaacattaattcaagatgaaatagatacactttatgctttgctgggtgaagtc
aaacagtcagctgttcgtggcacagaaacggcttttgatgtgatagaaggctacattcag
cgtatcgtgagcgatattcaattgaagcgccctttaaaagtagttgttgattgtggaaat
ggtgtggcgggtccaattattcccagggctatttcaaaattaggctgtgaagtcattccc
ctgtattgtgaagtggatggtcgatttcccaatcatcatcctgacccttcaatagaagct
aatttagttgatttaaaagcggctgtggcaaatcatcaagctgatattggtttgggcttt
gatggggatgctgacagacttggcctagtgacaaataaaggcgaagtgatttggcctgat
cgtttaatgatgttttactcacgagagattttaagtcgtaatccaggtgctactgttgtg
tttgatgtgaagtgctccagtcatttggagaaagaaatccaggcagcaggcggtgttgcc
agaatgtgccccactggccattcaattgtgaaagcggtgatgaaaaaagaacaagccatc
ttggctggcgaaatgagcgggcatctgttttttaaagatcgctggtatggatttgacgat
gctttatatagcgcatgccgattgttagagattatcagtttttcccatttgactgtcagt
gaacaatttgagttgatccctaatagtgtcaatacacctgaaataaaaatagcgattact
gatgaagaaaaatttgattttattcagcgttttagtgagcaggctgatttccctgaaggt
aggattttgaatattgatggtttgcgtgttgaatttccaaatggatggggattgttacga
gcatcaaacacaactccttgtctggtcgcacgttttgaggcgacagataaagatcatctg
gagcaaattcaatatttgtttaagaaacaaattcagcgcttggattctgagttggatttg
ccattttag

DBGET integrated database retrieval system