KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_2480Help
Entry
lp12_2480         CDS       T01726                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00770  Pantothenate and CoA biosynthesis
lpe01100  Metabolic pathways
Module
lpe_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    lp12_2480
Enzymes [BR:lpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     lp12_2480
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     lp12_2480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PspC AlaDh_PNT_C Glyco_trans_4_4 DUF3943
Motif
Other DBs
NCBI-ProteinID: AEW52724
Position
complement(2762616..2764004)
Genome map
AA seq 462 aa AA seqDB search
MLPELMKTANNSISERLCTPLVSSFSRKSSCCAVWATIILYSFYIPLLRSLCFDRGYSYQ
KWRSMQDFINKKILLGVCGGIAAYKSAHLVRELTRLGADVRVVMTHSAQQFINPLLMQAL
SGNEVRIDLFDTQAERAMGHIELARWADYLLIAPASANCLAKMAQGLADDLLSTLYLVTE
TPVIVCPAMNRSMWAHPATKANCELLKERGVFFVGPEEGSQACGEHGLGRVSEADQIVNT
LRLLDVNQLLHGKRIVITAGPTRESIDPVRYLSNYSSGKMGFAMAEAAAMAGAQVTLISG
PCHLQTFSDIEVIRVESAQSMLEEVNRHVQQGDVFIGTAAVSDYRVLNPASEKMKKNENS
ELTLQLVRNADILSEVAKSGKASFVVGFAAETTDVISYAKEKMKNKKLDMIIANQVGNGM
GFESDVNQVTVITKNKQIELPLTHKTRLAGQIIAILAASLQN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgttacccgaactgatgaaaacggctaacaattcaatatcagagaggctatgtactcca
ttagtaagtagtttttcgcgcaagtcaagttgctgcgctgtatgggcaaccatcattttg
tattccttttatattcctttattgcgaagtttgtgctttgatcggggttattcttatcaa
aaatggcgatccatgcaagattttattaataaaaaaattctacttggtgtttgtggcggc
attgctgcttataaatctgctcatctggttagagagttaactcgtttgggggccgatgtg
agggttgtcatgactcattcagcacaacagttcattaaccctttattgatgcaggcatta
tcaggcaatgaagtgaggattgatttattcgacactcaagctgaacgggctatgggacat
attgaattagccagatgggcagattatttgctcattgctcctgcgtctgcaaattgtctt
gctaaaatggctcaaggtcttgctgatgatttgctttcaacattatatctcgttactgaa
acgccagttattgtttgtcctgccatgaacagaagcatgtgggcacatccagcaaccaag
gcaaattgtgaattgttaaaagaacgaggtgtgttttttgtcgggcctgaagaaggctcc
caggcctgtggggaacatggattgggaagagtcagcgaggcggatcaaattgtgaatacc
ttgcgcttactggatgtgaatcaactattgcatggcaaacgaattgtgattactgcaggc
cctactcgcgagtcgattgatccagttcgttatttaagcaattacagttcagggaagatg
ggttttgcaatggctgaagccgccgctatggcaggcgcacaagtgacattaattagtggt
ccttgtcatttacaaacgttttcggacatcgaggtcataagagtggagtctgcacaatcg
atgctggaagaagtgaacagacatgtacaacagggagatgtatttattggaacagccgca
gtatcagattatagagtgctgaatcctgcttcggaaaaaatgaaaaaaaatgaaaactct
gaactcactctccagcttgttagaaatgcagatattctttctgaagtagctaaaagtggt
aaagcttcctttgttgttgggtttgcagctgaaacaactgatgtgatttcctatgcaaaa
gaaaaaatgaaaaataaaaaactggatatgattatcgccaatcaggtaggtaatggaatg
ggattcgaaagtgatgtaaatcaagtaacagtgattacaaaaaacaaacaaatagagctg
ccattaacccataaaacacgcctggcaggccaaattattgcaatccttgctgcaagtctg
caaaattag

DBGET integrated database retrieval system