KEGG   Legionella pneumophila Lens (serogroup 1): lpl0126Help
Entry
lpl0126           CDS       T00208                                 

Gene name
acsB
Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00010  Glycolysis / Gluconeogenesis
lpf00620  Pyruvate metabolism
lpf00640  Propanoate metabolism
lpf00680  Methane metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpl0126 (acsB)
   00620 Pyruvate metabolism
    lpl0126 (acsB)
   00640 Propanoate metabolism
    lpl0126 (acsB)
  Energy metabolism
   00680 Methane metabolism
    lpl0126 (acsB)
Enzymes [BR:lpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     lpl0126 (acsB)
Lipid biosynthesis proteins [BR:lpf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   lpl0126 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAH14356
Pasteur: lpl0126
UniProt: Q5X095
Position
complement(149196..151154)
Genome map
AA seq 652 aa AA seqDB search
MSIKALVISIFQPLLNTLAKHKRCSMLPVHLKHPHLTPTEESLSEFWSEIAAQTIDWIQP
WSITLQGGLHKGDVKWFQGGLLNVSASCLDRHLPHKANQTAIIWEGDDENQNKTLTFAQL
YSEVCKMSNVLKSLNVRKGDTVGIYLPMIPEAAIAMLACARIGAIHTVVFAGFSAHALQQ
RLIASSCKCLITADAFQRGAKTIPLKKQADEASVDLNITKLVVKNSNAPTTLNKSKEHWW
HELKQTVSDQCTPEPMNAEDPLFILYTSGSTGQPKGVVHTTGGYLVQTAYTHQLIFACQD
NEVFWCTADIGWITGHSYVVYGPLCNGITTLMFEGIPTWPDAARNWRIIDKHQVNVFYTA
PTAIRSLMRAGDQWLNSSSRSSLRLLGSVGEPINPEAWNWYHQKVGQGKCPIVDTWWQTE
TGAIMISPRASDEVIKPGSACKPIPGIVPVLLNEQGHEINGAGEGLLAIKYPWPSMARTI
AGDHQRYCNTYLSNGYYITGDGAKRDEDGDYWITGRIDDVLNVSGHRLGTAEIESALVSH
PKVAEAGVVGIPHDLKGQGIFAYVILKQGNKPDTKLQTELMERVKDEISAIAKPDVIQFV
NDLPKTRSGKIMRRILRKIACKEVSHIDELGDLTTLANPQIVEELMKNILKR
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatcaaggccttggtgatatcgatttttcagccattattaaacacattggcaaaa
cacaagaggtgtagcatgcttcccgttcatctaaagcaccctcatttaacacctacagaa
gaatctctatctgaattttggtctgaaattgccgcacaaaccattgactggatacaacct
tggagtatcaccctgcagggaggattacacaaaggcgatgtgaaatggtttcaaggcgga
ttgctcaatgttagcgctagttgtctggataggcatttaccccataaagcaaatcaaaca
gccatcatttgggaaggtgatgatgaaaaccaaaataaaaccctgacttttgcgcagctt
tattctgaagtatgcaaaatgagcaatgtgttaaaaagcctaaatgtccgcaaaggagat
acggtaggcatttacctacccatgattcctgaagcggccattgccatgctggcttgtgct
cgtataggagctattcataccgttgtgtttgccgggttttcggcccatgcattgcagcag
cgattaatagcttcttcctgtaaatgcttaatcactgcagatgcgtttcaacgcggtgca
aaaactatccctttaaagaaacaggctgacgaagccagcgtggacttaaatatcaccaag
ctggttgttaaaaattcaaatgccccaacgacactaaataagagcaaagaacattggtgg
catgagctaaaacaaaccgtatcggatcaatgcacgccggaaccaatgaacgccgaagat
cccctgtttattctctatacttccggaagcacgggacagccgaaaggagtggtacatacc
acaggcggctatttagtgcagaccgcttatacgcatcaactgatatttgcttgtcaggat
aatgaagtattttggtgtactgctgatatcggttggattacagggcatagttatgtcgtc
tatggccctctctgcaatggcattaccacattgatgtttgaaggaatacccacgtggcct
gacgcagcaagaaactggcgcatcattgataagcaccaagtgaatgtgttctacacagct
cccacggccattcgctccctgatgagagctggcgatcaatggctaaactcaagctcaaga
agttctcttcgtttactgggttcagtgggtgagccaattaacccggaagcatggaattgg
tatcaccaaaaagttggacaagggaaatgcccgatagtggatacatggtggcaaactgaa
actggagccattatgattagtcccagagccagtgatgaagtgatcaaaccaggctctgct
tgtaaacctattccggggatcgtaccagtcttgttaaatgagcaaggacatgaaattaat
ggcgctggagaaggccttttggctatcaaatacccatggccttctatggcaagaaccatt
gcaggagatcaccaaagatactgtaacacttatttatccaacggctattacatcactggt
gatggggccaaacgagatgaggatggagattattggattacaggccgaattgatgacgta
cttaatgtttccggccatcgattaggtactgctgaaattgaatcagcattggtcagccat
cctaaggttgctgaagctggcgttgtaggtattcctcatgatttaaaagggcaaggaata
tttgcctatgtcattctgaagcagggaaataagccggataccaagctccaaactgaattg
atggagcgagtcaaagatgaaatcagtgctatcgccaaaccagatgtcattcagtttgta
aatgatttgccgaaaacccgttcaggtaaaattatgcgccgaatactaagaaaaattgct
tgtaaagaagtgtcgcacattgatgagctgggtgatttaacaactcttgctaaccctcag
atcgttgaggaactcatgaaaaatattttgaagcggtaa

DBGET integrated database retrieval system