KEGG   Legionella pneumophila Lens (serogroup 1): lpl0579Help
Entry
lpl0579           CDS       T00208                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase, E2 subunit
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00020  Citrate cycle (TCA cycle)
lpf00310  Lysine degradation
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
Module
lpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpl0579 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    lpl0579 (sucB)
Enzymes [BR:lpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     lpl0579 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAH14810
Pasteur: lpl0579
UniProt: Q5WZ05
Position
626760..627989
Genome map
AA seq 409 aa AA seqDB search
MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL
FNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKSTSPVVR
RMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAEVQKESSMKALSFGGREE
KRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSFEKKHGVKLGFMS
FFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVVPVIRDADQLSMAEIE
LAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPPQTGILGMHKIEERPI
VEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRLLLNV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagtcaaagtacctgttctacccgagtcagtagctgatgcaacagtggct
gcgtggcataagaaagtgggtgataaagtatctcgcgatgagaacctagttgatctggaa
acagataaagttgtgcttgaagttccatcacctgtggatggggtattgtctgacattctg
tttaataccggagatacggttggttcaggagacttactggcaaaaatttctcaaagtgtt
tctgtagaatctcaaaaaactgagaaagaagagaaacctgtcaaaaaagaagaaataaaa
atttccgaaagtgaatcagttagcacaaaagaagataagtcaaccagtccggtagtaaga
cggatgatggctgaaaatgatttgaaagccgggcagattcaaggtaccggtaaagatggc
aggatcaccaaagaagatgttttatcttacatagaatccaatagagaaaaatcaaaccaa
actgctgaagttcaaaaagaatcttctatgaaagcactttcttttggtggcagggaagaa
aaacgtgtccctatgacgagactaagagccaagattgcggaacgtttattacaagcacag
cacaatgctgccatgttaaccacttttaacgaagtgaatttaaaggcagttatggatatg
cgttctcagtataaagatagctttgaaaaaaaacatggtgtaaaacttggatttatgtct
ttttttacgaaggcggtagtggagtcacttaaacgatttccggctgtaaatgcttcaatt
gatggccaagatattgtttatcatggcttctatgatataggaattgctgtttctactgaa
agaggtttagtcgttccggtgattagagacgctgatcagttaagtatggcagaaattgaa
ttagccattaatgacgctgcatcaaaagccagaaccggaaaattatctatggaagagatg
caaggggggacatttaccataactaacggtggagtcttcggttcactattagctactccc
attatcaacccaccgcaaactggtattttagggatgcataaaattgaggaaagacctatt
gtagagaaagggcaaatagtaatccgtcctatgatgtatgtcgctttatcctatgatcat
cgtttaattgatggaaaagattctgtacaatttttagtgagtgttaaagagctgttggaa
gatccatctcgacttttactgaatgtttaa

DBGET integrated database retrieval system