KEGG   Legionella pneumophila Lens (serogroup 1): lpl0580Help
Entry
lpl0580           CDS       T00208                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00020  Citrate cycle (TCA cycle)
lpf00640  Propanoate metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
Module
lpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpl0580 (sucC)
   00640 Propanoate metabolism
    lpl0580 (sucC)
   00660 C5-Branched dibasic acid metabolism
    lpl0580 (sucC)
Enzymes [BR:lpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     lpl0580 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAH14811
Pasteur: lpl0580
UniProt: Q5WZ04
Position
628052..629215
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKQLFASYGLPVPRGEVAYNVEDALLVASQLSTSRWVVKAQVHAGGRGKAGGV
KLVSSKDELAAVAKSMLGTRLVTYQTDARGQPVNAILVEETCEIDKELYLGAVVDRSTRR
VVIMASTEGGVEIEKVAHETPEKIFKVVVDPLVGVMPFQCRETAFKLGLKDDQIKQFTHL
MMGLGKMFVDCDLSLLEINPLVITKSGQLICLDGKINIDGNALFRQPKLKNMRDVSQEDD
RENRASDWELNYIPLDGTIGCMVNGAGLAMATMDVIKLHGGEPANFLDVGGGATKERVSE
ALKIIVSDEKVKGILVNIFGGIVRCDLIADGILAAVKEVDVKIPVVVRLEGNNAQLGAEI
LNKSNLNVIAATSLTDAAKKIVAAVSE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaagccaagcaattgttcgctagctatggtttaccagttcct
cgtggtgaggtcgcttataatgttgaggatgccttgctcgttgcttctcaattatcaacc
tctcgatgggttgtgaaagcacaagtccatgctggtggaagaggtaaagcaggtggtgtg
aaactggtttctagcaaagatgaattggctgcagttgcgaaatccatgttaggcacacgt
ctggttacttatcaaactgatgccagaggccaaccggttaatgctattttggttgaagaa
acctgcgaaatagacaaggaattatatcttggtgctgttgttgatagatccaccagacga
gttgttattatggcctctacagaaggtggtgttgaaattgaaaaggttgctcatgaaaca
cctgagaaaattttcaaggtggttgttgatcccttagttggtgttatgccttttcaatgt
cgtgaaacagcttttaaacttggattaaaagacgatcaaatcaaacaattcactcatttg
atgatgggattagggaaaatgtttgttgattgtgatttaagtttattagagataaatccg
cttgtcataacaaaatcagggcaactaatttgtctggatggaaaaattaatatcgatgga
aatgctttattccgacagcctaaactgaaaaatatgcgagacgtttcccaggaagatgat
cgagaaaatcgtgctagtgattgggagcttaattatattcctttggatgggacaataggt
tgcatggtaaatggtgctggtttggctatggctaccatggacgtgataaaattacatggt
ggtgagccggctaatttcctggatgttgggggaggcgccacaaaagaaagagtcagtgaa
gctttgaagattattgtgtcagatgaaaaagtcaaaggaattctagttaatatttttggt
ggaatcgttcgttgtgaccttattgctgatggaattcttgctgctgtaaaagaagtggat
gtaaaaattcctgttgttgtcagactggaaggtaataatgcccagctaggtgctgagata
ttgaataaaagcaatttaaatgtgattgctgcaacgagtttgacagacgcagccaagaaa
attgtagcagcagtttccgaataa

DBGET integrated database retrieval system