KEGG   Legionella pneumophila Lens (serogroup 1): lpl0849Help
Entry
lpl0849           CDS       T00208                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00020  Citrate cycle (TCA cycle)
lpf00480  Glutathione metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
lpf01210  2-Oxocarboxylic acid metabolism
lpf01230  Biosynthesis of amino acids
Module
lpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpl0849 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    lpl0849 (icd)
Enzymes [BR:lpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     lpl0849 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: CAH15083
Pasteur: lpl0849
UniProt: Q5WY90
Structure
PDB: 

Position
964108..965364
Genome map
AA seq 418 aa AA seqDB search
MTYDKIKVPAQGEAITVAADHSLHVPDNPIIPFIEGDGIGVDVTPPMIRVVDAAVQKAYG
NKRKISWMEVYAGEKATKVYGGDQWLPKETLDAMKKYVVSIKGPLTTPVGGGIRSLNVAI
RQDMDLYVCLRPIRYFNGVPSPVREPWKTDMVIFRENSEDIYAGIEWQADTPEAKKVIQF
LTQEMGVKKIRFPEHCGIGVKPVSREGTTRLVKAAIQYAIDNDRSTVTLVHKGNIMKFTE
GAFKDWGYQVARDSFGAKEYQGGPWMEFKNPKTGKQIIINDVIADAFLQQILLRPEDYSV
IATLNLNGDYISDALAAQVGGIGIAPGANISDQMAVFEATHGTAPKYAGQNKVNPGSIIL
SAEMMLRHMGWYEAADLIIRGMEGAIEAKTVTYDFERGMQGATLVSSSGFADAMIKHM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgataaaatcaaagtgcctgcccaaggcgaagctattactgttgctgctgac
cattcacttcatgttcctgataatccaattattccttttattgagggtgatggtatcggt
gttgatgtaacacctccgatgatccgtgttgttgatgctgcagttcaaaaagcatatggc
aacaagaggaaaatttcctggatggaggtttatgccggggaaaaggctactaaggtttat
ggtggcgatcaatggcttcccaaagagactctggatgccatgaaaaaatatgtggtttca
attaaaggtcctttaactacccctgttggtggcggtatacgttcattgaatgtcgctatt
cgccaagacatggatctctatgtttgtttacgtccaattcgctattttaatggtgttcca
agcccagttcgggaaccatggaaaaccgatatggttattttcagggaaaattctgaagat
atttatgccggtattgaatggcaggcagataccccggaagctaaaaaagtgattcaattt
ttaactcaggaaatgggtgttaagaagattcgttttcctgagcattgtggtatcggtgta
aagcctgtttccagagaaggtaccactcgacttgtcaaagcggcaattcagtatgcaatt
gataatgaccgcagtacagtgactctggtacataaaggcaatatcatgaagtttactgaa
ggggcttttaaagattggggatatcaggttgcgcgcgattcttttggagcaaaagaatat
caaggtgggccatggatggaatttaaaaatcctaaaaccggtaagcagattatcattaat
gatgtgatcgctgatgcctttttgcaacaaatcctgttaagacccgaagactatagtgtc
attgctacattaaatttgaatggtgattatatttctgatgctttggctgctcaggttggc
ggaataggtatagctcccggagcgaacattagtgatcaaatggctgtgtttgaagcaact
catggaacagcgcctaaatacgctggccagaataaagtaaaccccggttctattattctt
tctgccgaaatgatgttacgtcatatggggtggtatgaagcggctgatttgattatcaga
ggtatggaaggcgcgatagaagccaaaaccgtaacttatgattttgaacgtggtatgcaa
ggagcaacgttagtcagcagctctggttttgcagatgccatgattaagcatatgtaa

DBGET integrated database retrieval system