KEGG   Legionella pneumophila Lens (serogroup 1): lpl1016
Entry
lpl1016           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C DUF853 DUF87 NACHT_N AAA_10 DUF308 CLP1_P BsuBI_PstI_RE_N
Other DBs
NCBI-ProteinID: CAH15251
Pasteur: lpl1016
UniProt: Q5WXS5
Position
complement(1149440..1151374)
AA seq 644 aa
MSNYPINNLLREPTEAWSAITCLSLSLLAYTQPHLFLLTQTMGLYAALALLIPGIYRAWQ
AIKVKRYHRRLLAMPTYALSTTEIPLSKNWLFLGKGFRWRPSHTQKLHQIKQVKNEKFMQ
RNYCYQLARRFCQNHEHTKLTKWLNTNSKLNPFRPDPPVGGSPFLHGVGEEDKPVYIPQD
VRVGHTFVVGTTRVGKTRLASILINQDIRNGDAVIVVDPKGDQDLVRDMMAACKVSGRTE
DFKIVHLGFPEQSAQYNPLKNFDQISEVATRITDAISAEGEGKQFAAFAWKYVNIVAICL
EEMNQPITYQTIAFYISRLEQLLMSYADNILPNHYHNYHQEIDEIIKEHDSKIGKNNKTK
SPMERHQAVVQYVKDHINKTIKSNNAEALHDQILIDLYDAAIMDKHYYDKITASVGPVLS
EINKSNASKILSSKAQPDEIELMDVIKNKKVLYIGLDSLTNPNIAQAVGKAFLSDLVSTA
GKIYKEPNARYTLNLHCDELSEIIQDSFVKILNKAGGAGFQVTAYAQTIQDMEVALGSRA
KAEVSEGNFNTLIMLRVKNEETANLLVKVLPQVGVVGHTQVSMVNDTPHGDDRVYFNTTN
EDRVQTSSVPMIGVDDIVSLPKGQAYLLMSGCEIYKVRIPLPNH
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgagcaattaccctattaataacctattaagagaaccaacagaagcctggtcagccatt
acctgtttatctctctccttactggcatatactcaaccgcatttgtttttactaacacaa
accatgggattatatgctgcactcgcattattaatccctggaatttatagagcctggcaa
gcaattaaagtaaaacgctatcaccgaagattattagccatgcccacctatgccctatcg
accaccgaaatccctttatccaaaaactggttgttccttggcaaaggctttcgctggcga
ccaagccacactcaaaagctacatcaaattaaacaagtcaaaaatgaaaagttcatgcaa
cgaaactattgctaccagcttgccagaagattctgccaaaaccatgaacacacgaaatta
accaaatggctaaataccaattcaaaactaaatccttttagacctgatccacctgttggc
ggtagcccgttcttgcatggcgtaggggaagaagataaacccgtatacatccctcaagat
gtacgtgtaggtcataccttcgtagtcggtacaaccagggtaggaaaaacacggttggcc
agcattctaattaaccaagacatacgaaatggcgatgctgttatcgttgtagatcctaaa
ggcgatcaagacctggttagagatatgatggcagcctgtaaagtatcaggacggacagaa
gatttcaaaatcgtacacttaggttttccagagcagtccgcacaatacaaccccttaaag
aatttcgaccaaatcagtgaggttgccacacgcatcactgatgcaatctcagcagaggga
gaaggaaaacagttcgcagccttcgcctggaagtacgtcaatatcgttgctatatgcctg
gaagaaatgaatcaacccattacctaccaaacaattgccttctatatcagccgattagaa
cagctgttaatgtcctatgctgacaacattcttcctaaccactatcataattatcatcaa
gagatagatgaaatcatcaaggaacatgatagtaaaataggaaaaaataataagacaaaa
tctccaatggagcgtcatcaggcagtcgttcaatatgtcaaagatcacataaacaaaacc
atcaagagcaacaatgctgaagctttgcacgatcaaatactgatcgacctctatgatgca
gccattatggacaaacactattacgacaaaatcaccgccagtgttggtcctgtactttct
gaaatcaataaaagcaatgcctcaaaaatcttatcgtcaaaagctcaaccagatgaaatt
gaactgatggatgtaattaaaaacaagaaggtgctttatattggcttagacagcctaaca
aatcccaatattgcccaagcagtaggaaaagcctttttgtctgatctggtgtctacagct
ggtaaaatctataaagaacccaacgcacgatacactttaaatctacactgcgatgagttg
tcagagattatccaggattcatttgtgaagattcttaataaagctggcggtgctggattt
caggtcactgcttatgctcaaacaattcaagatatggaagttgcacttggttccagagct
aaagcagaagtatctgaaggaaattttaataccctgattatgctgcgtgttaaaaatgaa
gaaacagccaatttactggttaaagtactgcctcaagttggtgttgtcggacatacacag
gtttctatggttaacgatacgccacatggggatgatagggtttattttaatacgactaat
gaggatcgggttcaaacttcttcagtgcctatgattggggtggatgatattgtttcatta
cctaaaggccaggcttatttattaatgtctggttgtgaaatttataaagttagaattcca
ttacccaaccattag

DBGET integrated database retrieval system