KEGG   Legionella pneumophila Lens (serogroup 1): lpl1022
Entry
lpl1022           CDS       T00208                                 
Name
(GenBank) hypothetical protein
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
SSDB
Motif
Pfam: TraC_F_IV DUF87 P-loop_TraG AAA_10 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: CAH15257
Pasteur: lpl1022
UniProt: Q5WXR9
Position
complement(1155794..1158544)
AA seq 916 aa
MKRLSNWLLGEMNPQAIKELTIKKQYANPLPSFADRLAIVDFNEQEQVFLFADGKSLGSG
FELGDIQAEAASPEYLHAVFNKIRDTFATVVPLHAIDPWVMQMFVQDEYCLDPVIDHIKA
QIPQQFIESSLTQDYLQRLQDLYNKMTRPEGLFLDPKTGAPYRGRRRRIRVLFYRQLHQT
TLTREQILLEHQEVISQIETKLRSPGLEIKRLKGQDYYQWWIRWFNPKSADEILEQYPYP
NHIPAGFNLAQNIFFSPPESDEQGFIFEGRKQRILYVDGLKEAPIIGLVSRERQQANPKH
RYALLDTLPEGSIYTIQVVFSHDENLDSHLTRLEKGIVGTSLKPQEVRDDIKTARNELSI
GNRLFWVNQAVFYQAEDEKQAQAIEKNLHTIFNDAKMPLIHSSYDIHPLNSWLNALPFNF
DPRYARKYLCFDRLMYATELAALLPVYGRNQGARHLPCFPFFNRLGEPVFFDLLHHDFIS
QNSHCAIFANSGGGKSVLTGWMIQSLLAMKNARVVLFEMGNSFDRMLVHAKAHGKKTKQL
LLSNKKEEAVPLNPFCEAYKAIPEITDNLSAEQAALIAQKIMDLKDPAHSEDLACGVGSR
AYLAELALALRTMITEANSMEEEQFTLADETLLIEVLIDAILTSFNEGIPQMLTEHIVSA
FQRRLDKETVTRKKDRILDMHDRLNSYVINSAKSRFFNVPTEPLGDFDIFHIDISAIKDD
TGKLALVMVSLLPRILAMAEATQNDNRPTFLFIDESHLQFQIPSVVTVCLLVAKVARKLG
LWLVAITQNVTDMNSEKAAKILSLIETWILLGLDEKEITDVKRFKSLTPQQETLIRDIDS
QKGLYAEAVLLGSRYQGLFRVIPPRYLLALLMTEKSEKAQRHLLEKEHDVLEAAEIMAKK
LEQPKTTTNNRAYFYD
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgaaacgattatctaactggttgcttggggaaatgaatccccaggctataaaagaacta
accattaaaaagcaatacgccaatcctttgccctcgtttgctgacaggctggccattgtt
gatttcaacgaacaagaacaagtgtttttatttgctgatggaaaaagtttaggttcaggg
tttgagctaggtgatattcaagccgaagcagcttctcctgaatacttgcacgctgtcttt
aataaaatccgcgatacctttgcaacagtggttccactacatgcaatagacccttgggtt
atgcaaatgtttgttcaagacgaatattgccttgatccggttatcgatcatattaaagcc
caaattccacaacagtttattgaaagctcattaacgcaagattacttacaacgcctgcaa
gatctctacaacaaaatgaccaggccagaaggtttatttctcgatcctaaaacaggtgcg
ccctatcgaggacgaagacgacgaatcagagtattgttttatagacaactacatcaaacc
actttaaccagagaacaaattcttctcgaacatcaagaagtcatcagtcagattgaaacc
aaactacgctcaccgggtttagaaatcaaacgccttaaaggtcaagattattatcagtgg
tggatacgctggtttaatcctaaatcagccgatgagatcttggaacaatatccctaccct
aatcacatacccgcaggttttaatctggcacaaaatatattcttttcaccgcctgagagt
gacgaacaaggatttatttttgaaggccgaaaacaaagaatcctgtatgttgatggctta
aaagaagcacccattattggtttagtctcccgagaaagacaacaagccaatcctaagcac
cgatatgcgcttttagatactttgccagaaggaagcatctacactattcaagtcgtcttt
agccatgatgaaaatcttgattcccatttaacacgattagaaaagggaattgtgggaacc
agcctaaaaccccaagaggtcagagatgatataaaaacagcccgtaatgaattaagtatt
ggcaatcgtttattctgggttaatcaggccgttttttatcaagcagaggatgaaaaacaa
gcacaagccatagaaaaaaacctgcataccattttcaacgatgcaaagatgcccttaatt
cattccagctatgatatccaccctttaaattcctggctcaatgccttgccgtttaatttc
gatccccgctatgcccgtaagtacttatgctttgaccgtctgatgtatgccacggaactt
gcagcattgcttccagtttatggccgaaaccaaggggcaaggcatctaccctgctttcct
tttttcaaccgcttaggcgaacctgtattctttgacttgttacatcatgattttattagc
cagaattcacattgcgccatcttcgctaactctggtggtggtaagtcagttttaacaggt
tggatgattcaatcattactcgccatgaaaaacgcccgtgtagtactttttgaaatgggg
aactcgtttgatcggatgctcgttcatgccaaagcccatggtaagaaaaccaagcaatta
ttattaagcaataaaaaagaagaagctgttccattaaatccattttgtgaagcgtataaa
gcaattccagaaataacagataatttaagcgcagaacaagctgctttaatagctcaaaaa
atcatggatcttaaagatcctgctcactcagaagatttagcttgtggtgttggttctcgt
gcataccttgcagagcttgctttagctttgcgtactatgattaccgaagccaattccatg
gaagaagaacaatttaccctagctgatgaaacgctgctaatcgaagtattaattgatgcc
attctaacgtcatttaacgagggcataccacaaatgctgacagagcatattgtgagtgca
tttcaacggcgattagataaagaaactgtgacgcgcaagaaagatcggattctggatatg
cacgaccgattaaacagttatgtcattaacagcgccaaatcacgcttttttaatgtacca
acagaacctttaggtgattttgatatctttcatattgatatttctgccattaaagatgat
accggaaaactggctttggtcatggtgtctttgttgccaagaatactggctatggcagaa
gccactcaaaacgacaataggccaacctttctttttattgatgaatcccatctgcaattt
caaattccttctgtggtgacagtgtgtctactggtagccaaagtagctagaaaactcggg
ctttggctggttgcaattacccaaaacgttaccgacatgaattctgaaaaggctgcaaag
attttatcgctaattgaaacctggattttgttgggactggatgaaaaagaaatcactgat
gtgaaacgctttaaatctttaacaccgcagcaagaaacattaatcagagatattgattcg
caaaaaggtttgtatgcagaagcagttttattagggtcacgctaccaaggattatttcgc
gtcattccacctcgctacctgcttgccctcttaatgactgagaaatctgaaaaagcacaa
cgccaccttctggagaaagaacatgatgtccttgaagcagctgaaatcatggctaaaaag
ctcgaacaaccaaaaacaactactaataacagggcttatttttatgactaa

DBGET integrated database retrieval system