KEGG   Legionella pneumophila Lens (serogroup 1): lpl1031
Entry
lpl1031           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: CAH15266
Pasteur: lpl1031
UniProt: Q5WXR0
Position
complement(1162864..1163496)
AA seq 210 aa
MAVKQYSRQLTMQLTIVLFLGWLAIIIWALSQWMLHGYPIAFEKVNILVNTQREAISPVY
QGSLLAVLPLNAKPDWALAIPYVNKLVINDLAKDLIEKSQQFLQILLLSSQCLLIKLIIL
FAALPLFALTMIAGLVDGLNQRAIRTACLGRESSYVFHRLNHYLKKGLVILLMLWLALPV
SITPAYVFVPISLLMGLMVAMTASRFKKYL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcagtaaagcaatattcaaggcaactgaccatgcaattaaccatagtgctattctta
ggttggttagcaattattatctgggcattgagccaatggatgctgcatggctaccccatc
gcttttgaaaaagtgaatatccttgtaaacactcaaagagaggctattagtcctgtttat
caaggctcccttctggcagtccttcctttaaatgccaaaccagattgggcattagccatt
ccttacgtaaacaaattggtcattaatgatcttgccaaggatttaatcgaaaaatcacaa
caattcttgcaaatccttttattaagcagccagtgccttttaatcaaactcattatctta
ttcgctgccctgcccttatttgctttaaccatgattgcaggtctggttgacggactaaat
caaagagcgatacgcactgcttgtttaggccgtgaatcctcttatgtgtttcacaggctt
aatcactatttaaaaaagggtcttgtgattttacttatgctgtggcttgccctgcccgtc
agcatcacccctgcttatgtttttgttcctatcagtttattgatggggttaatggtagcg
atgacggccagccgttttaagaagtatttatag

DBGET integrated database retrieval system