KEGG   Legionella pneumophila Lens (serogroup 1): lpl1278
Entry
lpl1278           CDS       T00208                                 
Name
(GenBank) hypothetical protein
  KO
K08161  MFS transporter, DHA1 family, multidrug resistance protein
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpf02000]
    lpl1278
Transporters [BR:lpf02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    lpl1278
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: CAH15518
Pasteur: lpl1278
UniProt: Q5WX21
Position
complement(1425396..1426610)
AA seq 404 aa
MNKPVQKMMLSGQFLMILALEMTNPFLPLLIAHQSNTPVPSVVIYNTLSLILPMLANILL
TPIWGLAADRYGYKPMLMRASWALVLTQASMIVVNSVFWILIIRLLQGAFAGFLVAMQTY
ALSITEWQNKSTQLSRLQSSKAIATSTAGFLGGLALSFTNYQGLFGLATLICLGTTVAMH
YKLPSPPKHQIKKKSQTLNHSYTSKSVFFFLCVLIMLTQIAKFLPDPGFTLYLNKYCSNN
LVLIGFLYSLPAMGMLCSSVWCGKQFDYCRSQPSLVNQYLIRYSVFGAILMIIQANVDNF
YLFALIRILWGIVLAALLPALFTLCSDRNLLPGYALGLANSFAKLGNLIGLLLGGLFAFY
LPYPAIFMIIAGIYSLFAIFVYGYDRLNVRQMTDFSNSYFNMKS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgaataaaccagttcaaaaaatgatgctctcaggtcagtttttgatgatattggcctta
gaaatgacgaatccctttctaccactattgatcgcgcaccaaagcaacacaccagtacca
tcggtagtgatttataacacgctgagtctaattctaccgatgctggctaacattctatta
accccaatctggggcttggcagctgatcgatatggctacaaacccatgttaatgagagca
tcctgggccttggtgttgacccaggccagtatgattgttgtaaattctgtattctggatt
ttaatcatccgattacttcaaggagcttttgcaggttttcttgttgcaatgcaaacctat
gcactaagcattactgaatggcaaaacaaaagcacacagttatctcgcttgcaatcctcc
aaggcaattgccacttctacagccgggtttctcggaggattagctttaagcttcactaac
tatcaaggattatttggtttggcaacattgatatgcctgggcactactgtagcgatgcac
tacaaattaccctcgccaccaaagcaccagataaagaaaaaatcacaaacattaaatcat
tcttacacatcaaaaagtgttttcttctttctttgcgtattaatcatgctaacccaaatt
gccaagtttttacctgatccagggtttaccctgtatctaaataagtattgttcaaataat
ctggtactaattggatttctttattctttaccggcaatggggatgctatgtagttcagta
tggtgtggcaaacagtttgactactgtcgaagtcaaccttctttggttaaccaatattta
atacgctatagcgtattcggagccatcctcatgatcattcaagccaatgtagataatttc
tatctgtttgctcttatacgtattttgtgggggatcgtacttgcggccttattgcctgcg
ttatttactttgtgcagtgatcgtaatttgttaccaggttatgccttgggattagccaat
tcatttgcaaaactgggaaatctaattggattgttattgggtggtctttttgcattttat
ctaccatatcctgcaatttttatgataattgccggaatttatagtttattcgcgattttt
gtttacgggtatgatcggctaaatgtcaggcagatgacagatttttctaattcttatttt
aacatgaaatcatga

DBGET integrated database retrieval system